| Clone Name | rbast06g05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y208_BACHD (Q9KGA4) Hypothetical protein BH0208 | 28 | 5.9 | 2 | EPL1_ASPFU (Q4WDF1) Enhancer of polycomb-like protein 1 | 28 | 5.9 | 3 | UPPS_MYCPF (Q93AU4) Undecaprenyl pyrophosphate synthetase (EC 2.... | 28 | 7.7 |
|---|
>Y208_BACHD (Q9KGA4) Hypothetical protein BH0208| Length = 459 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 4 GAQIFILLHLQSTGSLKQQHEQRQVEGITDRLTEK 108 G + I+LHL G K++ +++VEGI D L + Sbjct: 419 GMGVGIVLHLMLIGLKKEELTEKEVEGIKDDLLSR 453
>EPL1_ASPFU (Q4WDF1) Enhancer of polycomb-like protein 1| Length = 582 Score = 28.1 bits (61), Expect = 5.9 Identities = 16/62 (25%), Positives = 29/62 (46%) Frame = +1 Query: 46 SLKQQHEQRQVEGITDRLTEKNYGFFVLDEKP*KRNSEVAASERPTRK*SQYPNQPPLRR 225 ++K E + +T + F L E+P K+ +E A++RPT + P +P + Sbjct: 295 NIKDDDEDLINQKVTSIPARLPHAFANLPEQPKKKPAEAPAAQRPTAPQIRMPQKPGTQA 354 Query: 226 GD 231 D Sbjct: 355 AD 356
>UPPS_MYCPF (Q93AU4) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 296 Score = 27.7 bits (60), Expect = 7.7 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +2 Query: 101 LKKITVFLYSTKNPKKETQR*QHPRGRHENEV-NTRTNRPCVGVTASCFGKCFLAWNEEV 277 +K +TV+ +ST+N K+ T+ + G + V R N +GV G W+ + Sbjct: 112 IKHLTVYAFSTENWKRSTEEVRFLMGFNREVVRRRRENLNDMGVRMRWVGSRPRMWSSVI 171 Query: 278 AEF 286 EF Sbjct: 172 KEF 174 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,956,321 Number of Sequences: 219361 Number of extensions: 721748 Number of successful extensions: 1981 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1971 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)