| Clone Name | rbast06f09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VNCS_PAVHB (P07298) Noncapsid protein NS-1 (Nonstructural protei... | 28 | 8.3 |
|---|
>VNCS_PAVHB (P07298) Noncapsid protein NS-1 (Nonstructural protein NS1) (NCVP1)| Length = 671 Score = 27.7 bits (60), Expect = 8.3 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +1 Query: 46 TILFSTPSHGPCYAKKNLITSGCYGNMDDRGQTLAAAVFVIHRYTSKGTPA 198 T + +T G C+AKK IT+ D G++ V+ + KGT A Sbjct: 163 TCISATFRRGACHAKKPRITTAINDTSSDAGESSGTGAEVV-PFNGKGTKA 212 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,969,453 Number of Sequences: 219361 Number of extensions: 434483 Number of successful extensions: 1007 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1007 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)