| Clone Name | rbast06d07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PALH_DEBHA (Q6BPR6) pH-response regulator protein palH/RIM21 | 28 | 8.1 | 2 | PGK_CAEEL (P91427) Probable phosphoglycerate kinase (EC 2.7.2.3) | 28 | 8.1 |
|---|
>PALH_DEBHA (Q6BPR6) pH-response regulator protein palH/RIM21| Length = 537 Score = 27.7 bits (60), Expect = 8.1 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = -2 Query: 198 ICIPEDFCQPCNSLRLLIEKVEILSKSFYMLSSIDDVRYH*KPF*MFVD 52 + IP ++C NS+ EK +L + FY +D Y F +FVD Sbjct: 316 VVIPWEWCNKYNSIMKAKEKEGVLGRKFY-----EDELYELDRFELFVD 359
>PGK_CAEEL (P91427) Probable phosphoglycerate kinase (EC 2.7.2.3)| Length = 417 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 158 NELHG*QKSSGIQIHFPVSLINREKIVVETTN 253 NEL K+ G+QIH PV + +K + T+ Sbjct: 266 NELLEAAKAKGVQIHLPVDFVIADKFAEDATS 297 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,132,762 Number of Sequences: 219361 Number of extensions: 553001 Number of successful extensions: 1180 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1180 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)