| Clone Name | rbast06b12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y36K_HALSN (P14321) Hypothetical 36 kDa protein | 33 | 0.15 | 2 | HRCA_CHLPN (Q9Z850) Heat-inducible transcription repressor hrcA | 30 | 1.6 | 3 | DEND_HUMAN (O94850) Dendrin | 28 | 4.8 | 4 | ICP4_EHV1V (Q6S6U0) Trans-acting transcriptional protein ICP4 (1... | 28 | 6.3 | 5 | DPOL_ADE04 (P87503) DNA polymerase (EC 2.7.7.7) | 28 | 8.2 | 6 | ICP4_EHV1K (P17473) Trans-acting transcriptional protein ICP4 (1... | 28 | 8.2 |
|---|
>Y36K_HALSN (P14321) Hypothetical 36 kDa protein| Length = 328 Score = 33.5 bits (75), Expect = 0.15 Identities = 21/65 (32%), Positives = 36/65 (55%) Frame = +2 Query: 47 FVRCPRICFDTFS*QIDSHRRNTQTNCRLSNEPILRGRIGRDAPAVSVLRAARPDRPNGA 226 FV+ P + + F +D+H +N++ R ++ ++ D AVS+ R+ARPDR +G Sbjct: 170 FVKGPVVA-EQFQDVLDAHVKNSEGAGREAHRAVVED--DEDEAAVSIRRSARPDREDGI 226 Query: 227 GRPGA 241 GA Sbjct: 227 ENLGA 231
>HRCA_CHLPN (Q9Z850) Heat-inducible transcription repressor hrcA| Length = 398 Score = 30.0 bits (66), Expect = 1.6 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +2 Query: 98 SHRRNTQTNCRLSNEPILR 154 S RR +NC+LSNEPILR Sbjct: 365 SFRRPLTSNCKLSNEPILR 383
>DEND_HUMAN (O94850) Dendrin| Length = 657 Score = 28.5 bits (62), Expect = 4.8 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 237 PGRPAPFGRSGRAARSTETAGASRPIRPRRMGSLLR 130 PGRP P R+ A R + AG P+RP R+ + R Sbjct: 86 PGRPRPEPRN--APRVAQLAGLPAPLRPERLAPVGR 119
>ICP4_EHV1V (Q6S6U0) Trans-acting transcriptional protein ICP4 (155 kDa| immediate-early protein) Length = 1487 Score = 28.1 bits (61), Expect = 6.3 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = -3 Query: 246 TPA----PGRPAPFGRSGRAARSTETAGASRPIRP 154 TPA P PAP R G+A RS AG+ P P Sbjct: 62 TPAVVIPPPSPAPEPRGGKAKRSPSAAGSGGPPTP 96
>DPOL_ADE04 (P87503) DNA polymerase (EC 2.7.7.7)| Length = 1193 Score = 27.7 bits (60), Expect = 8.2 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 3/66 (4%) Frame = -2 Query: 190 YGDGR---CVTPDTPAKNGLVAQAAICLRITPVAVDLLGKCIETNPRAADEICVFRRLSN 20 +GD R CVTP+ A Q L+ T +AVDL + NP AD LS+ Sbjct: 324 HGDPRTFYCVTPEKMAVGQQFRQYRDRLQ-TALAVDLWTSFLRANPHLADWALEQHGLSD 382 Query: 19 REPLVY 2 + L Y Sbjct: 383 PDELTY 388
>ICP4_EHV1K (P17473) Trans-acting transcriptional protein ICP4 (155 kDa| immediate-early protein) Length = 1487 Score = 27.7 bits (60), Expect = 8.2 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 Query: 237 PGRPAPFGRSGRAARSTETAGASRPIRP 154 P PAP R G+A RS AG+ P P Sbjct: 69 PPSPAPEPRGGKAKRSPSAAGSGGPPTP 96 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,606,680 Number of Sequences: 219361 Number of extensions: 672480 Number of successful extensions: 2331 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2174 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2331 length of database: 80,573,946 effective HSP length: 58 effective length of database: 67,851,008 effective search space used: 1628424192 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)