| Clone Name | rbast05h03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYSM_BOVIN (Q9N0F3) Seryl-tRNA synthetase, mitochondrial precurs... | 28 | 6.5 | 2 | MASS1_BRARE (Q6JAN0) Monogenic audiogenic seizure susceptibility... | 28 | 8.6 |
|---|
>SYSM_BOVIN (Q9N0F3) Seryl-tRNA synthetase, mitochondrial precursor (EC| 6.1.1.11) (Serine--tRNA ligase) (SerRSmt) Length = 518 Score = 28.1 bits (61), Expect = 6.5 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = -3 Query: 116 LSHSDAIRTAEI*RVCTVECYRACTE---QPW 30 + HS A R I VC+ CYRA T+ +PW Sbjct: 309 MDHSVAFRDLPIRMVCSSTCYRAETDTGKEPW 340
>MASS1_BRARE (Q6JAN0) Monogenic audiogenic seizure susceptibility protein 1| homolog precursor (Very large G-protein coupled receptor 1) Length = 6199 Score = 27.7 bits (60), Expect = 8.6 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 69 TNSLNFCGPYCIRMRQGQA 125 TN LNFC +C+R R QA Sbjct: 2418 TNVLNFCAAFCLRERACQA 2436 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,641,619 Number of Sequences: 219361 Number of extensions: 515366 Number of successful extensions: 1036 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1030 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1036 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)