| Clone Name | rbast05d07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DIG1_CAEEL (Q09165) Mesocentin precursor | 31 | 0.77 | 2 | UBR1_KLULA (O60014) Ubiquitin-protein ligase E3 component N-reco... | 28 | 6.5 |
|---|
>DIG1_CAEEL (Q09165) Mesocentin precursor| Length = 13100 Score = 31.2 bits (69), Expect = 0.77 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 6/49 (12%) Frame = +2 Query: 8 IIPHITYVF----LYITNPTCF--PCYKISSPHGSAPP*KISKGDN*IQ 136 ++P YVF +Y P+ F PC + P G+AP +IS GDN ++ Sbjct: 1774 LLPDTDYVFKMRAIYPDGPSVFSEPCIMKTLPDGNAPYIQISTGDNGVE 1822
>UBR1_KLULA (O60014) Ubiquitin-protein ligase E3 component N-recognin-1 (EC| 6.-.-.-) (N-end-recognizing protein) Length = 1945 Score = 28.1 bits (61), Expect = 6.5 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = +2 Query: 2 LCIIPHITYVFLYITNPTCFPCYKISSP----HGSAPP*KISKGD 124 L +IP+I+ V LY++ P C IS+P HG + I +GD Sbjct: 1697 LFLIPNISQVCLYLSRPDC--TVNISAPYLNSHGESGRNAIERGD 1739 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,159,211 Number of Sequences: 219361 Number of extensions: 470512 Number of successful extensions: 1183 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1183 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)