| Clone Name | rbast04c08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GMEB2_MOUSE (P58929) Glucocorticoid modulatory element-binding p... | 29 | 3.9 | 2 | PO2F3_RAT (P42571) POU domain, class 2, transcription factor 3 (... | 29 | 3.9 | 3 | GMEB2_RAT (O88873) Glucocorticoid modulatory element-binding pro... | 29 | 5.1 |
|---|
>GMEB2_MOUSE (P58929) Glucocorticoid modulatory element-binding protein 2| (GMEB-2) Length = 530 Score = 29.3 bits (64), Expect = 3.9 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = +2 Query: 161 SP*KESNMKRRVFDPGCLAFTIFLIHQSKLISPS---SNLTSMMVGQVSSTLPE*IL 322 SP K + R P +A + +SP S LTS+ +G+V STLP +L Sbjct: 354 SPMKRPRLARATSGPAAMASQVLTQSAQIALSPGMPVSQLTSVPLGKVVSTLPSTVL 410
>PO2F3_RAT (P42571) POU domain, class 2, transcription factor 3| (Octamer-binding transcription factor 11) (Oct-11) (Transcription factor Skn-1) Length = 430 Score = 29.3 bits (64), Expect = 3.9 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 233 IHQSKLISPSSNLTSMMVGQVSSTLP 310 I+ S+L+SPS +L S+ V V ST+P Sbjct: 344 IYNSRLVSPSGSLGSLSVPPVHSTMP 369
>GMEB2_RAT (O88873) Glucocorticoid modulatory element-binding protein 2| (GMEB-2) Length = 529 Score = 28.9 bits (63), Expect = 5.1 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 5/59 (8%) Frame = +2 Query: 161 SP*KESNMKRRVFDPGCLAFTIFLIHQSKLIS-----PSSNLTSMMVGQVSSTLPE*IL 322 SP K + R P +A + + QS I+ P S LTS+ +G+V STLP +L Sbjct: 353 SPMKRPRLARATSGPAAMASQV--LTQSAQIALGPGMPMSQLTSVPLGKVVSTLPSTVL 409 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,360,601 Number of Sequences: 219361 Number of extensions: 1287694 Number of successful extensions: 2693 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2693 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)