| Clone Name | rbast04c02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PCDAA_PANTR (Q5DRF4) Protocadherin alpha 10 precursor (PCDH-alph... | 30 | 1.9 | 2 | PCDAA_HUMAN (Q9Y5I2) Protocadherin alpha 10 precursor (PCDH-alph... | 30 | 1.9 | 3 | PNS1_YARLI (Q6C938) Protein PNS1 | 29 | 3.3 | 4 | PCDAC_PANTR (Q5DRF2) Protocadherin alpha 12 precursor (PCDH-alph... | 28 | 7.4 | 5 | PCDAC_HUMAN (Q9UN75) Protocadherin alpha 12 precursor (PCDH-alph... | 28 | 7.4 |
|---|
>PCDAA_PANTR (Q5DRF4) Protocadherin alpha 10 precursor (PCDH-alpha10)| Length = 948 Score = 29.6 bits (65), Expect = 1.9 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -3 Query: 337 APAM-ADPLGSAGGKVQEEVMREFAALMASGTLRASEA 227 APA+ A P GSAGG V E V+R A +RA +A Sbjct: 561 APALLASPAGSAGGAVSELVLRSVGAGHVVAKVRAVDA 598
>PCDAA_HUMAN (Q9Y5I2) Protocadherin alpha 10 precursor (PCDH-alpha10)| Length = 948 Score = 29.6 bits (65), Expect = 1.9 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -3 Query: 337 APAM-ADPLGSAGGKVQEEVMREFAALMASGTLRASEA 227 APA+ A P GSAGG V E V+R A +RA +A Sbjct: 561 APALLASPAGSAGGAVSELVLRSVVAGHVVAKVRAVDA 598
>PNS1_YARLI (Q6C938) Protein PNS1| Length = 571 Score = 28.9 bits (63), Expect = 3.3 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +2 Query: 29 YYVNKSDK*IEFHAAMLQYK*AIVPNYYQFAVASEIERV*NSFRQL 166 YY +KSD+ + HAAM ++ A+ + ++ S I + N RQ+ Sbjct: 348 YYCSKSDQGMPKHAAMSSFRRAVTYSLGSISLGSLIVSIINFIRQI 393
>PCDAC_PANTR (Q5DRF2) Protocadherin alpha 12 precursor (PCDH-alpha12)| Length = 941 Score = 27.7 bits (60), Expect = 7.4 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -3 Query: 337 APAM-ADPLGSAGGKVQEEVMREFAALMASGTLRASEA 227 APA+ A P GSAGG V E V R A +RA +A Sbjct: 562 APALLATPAGSAGGAVSELVPRSVGAGHVVAKVRAVDA 599
>PCDAC_HUMAN (Q9UN75) Protocadherin alpha 12 precursor (PCDH-alpha12)| Length = 941 Score = 27.7 bits (60), Expect = 7.4 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -3 Query: 337 APAM-ADPLGSAGGKVQEEVMREFAALMASGTLRASEA 227 APA+ A P GSAGG V E V R A +RA +A Sbjct: 562 APALLATPAGSAGGAVSELVPRSVGAGHVVAKVRAVDA 599 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,840,468 Number of Sequences: 219361 Number of extensions: 601319 Number of successful extensions: 1525 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1525 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)