| Clone Name | rbast03f08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MTFA_COLP3 (Q47YA5) Putative RNA 2'-O-ribose methyltransferase m... | 28 | 6.3 |
|---|
>MTFA_COLP3 (Q47YA5) Putative RNA 2'-O-ribose methyltransferase mtfA (EC| 2.1.1.-) Length = 368 Score = 28.1 bits (61), Expect = 6.3 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +2 Query: 83 VFLHGDSWVKGFRFQSLCTSINRGSNNLSPHFVGEPHIKYPTAT 214 +FL G + GF + N SPH +G P +K+P+A+ Sbjct: 155 LFLSGQEVILGFSL----------ARNSSPHVMGIPRLKFPSAS 188 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,045,598 Number of Sequences: 219361 Number of extensions: 635874 Number of successful extensions: 1465 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1465 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)