>TENA_PIG (Q29116) Tenascin precursor (TN) (Hexabrachion) (Cytotactin)|
           (Neuronectin) (GMEM) (JI) (Miotendinous antigen)
           (Glioma-associated-extracellular matrix antigen) (GP
           150-225) (Tenascin-C) (TN-C) (P230)
          Length = 1746

 Score = 27.7 bits (60), Expect = 8.4
 Identities = 18/46 (39%), Positives = 21/46 (45%), Gaps = 2/46 (4%)
 Frame = +2

Query: 89  GSIGYDSKRPNNPT*CA*LHR--DGACVVHSGPAGPDRIDRPGPAD 220
           G  G D +    P  C+   R  DG CV   G AGPD  D   P+D
Sbjct: 490 GYTGEDCRELRCPGDCSQRGRCVDGRCVCEHGFAGPDCADLACPSD 535


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 38,664,103
Number of Sequences: 219361
Number of extensions: 768867
Number of successful extensions: 2033
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1947
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2032
length of database: 80,573,946
effective HSP length: 51
effective length of database: 69,386,535
effective search space used: 1665276840
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)