| Clone Name | rbast03b10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YICF_ECOLI (P25772) Hypothetical DNA ligase-like protein yicF | 28 | 5.3 | 2 | IF2P_METAC (Q8TQL5) Probable translation initiation factor IF-2 | 28 | 6.9 | 3 | IF2P_METMA (Q8PU78) Probable translation initiation factor IF-2 | 28 | 6.9 |
|---|
>YICF_ECOLI (P25772) Hypothetical DNA ligase-like protein yicF| Length = 560 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +2 Query: 11 KAWFHFLVDVPCVQNSQWSSC*Q-SPARAYFNMS 109 K W L+ + C Q+S W+ C SPARA +S Sbjct: 2 KVWMAILIGILCWQSSVWAVCPAWSPARAQEEIS 35
>IF2P_METAC (Q8TQL5) Probable translation initiation factor IF-2| Length = 597 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = +3 Query: 48 YKILNGAAANKVRPVLISI*AIGGITHSNSNRHL---NIIIIVIGLNKE 185 +KIL G + +P ++ + +GG+ +N++ L N++ + GL E Sbjct: 473 FKILPGCVFRQSKPAVVGVRVLGGVVRTNADVMLENGNVVGKIKGLQSE 521
>IF2P_METMA (Q8PU78) Probable translation initiation factor IF-2| Length = 591 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = +3 Query: 48 YKILNGAAANKVRPVLISI*AIGGITHSNSNRHL---NIIIIVIGLNKE 185 +KIL G + +P ++ + +GG+ +N++ L N++ + GL E Sbjct: 467 FKILPGCVFRQSKPAVVGVRVLGGVVRTNTDVMLENGNVVGKIKGLQSE 515 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,117,149 Number of Sequences: 219361 Number of extensions: 818995 Number of successful extensions: 1821 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1821 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)