| Clone Name | rbast02f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HRPH_PSESY (Q01723) Hypersensitivity response secretion protein ... | 30 | 3.4 | 2 | SYG_STRCO (Q9L2H9) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine... | 29 | 4.4 | 3 | ITPA_MOUSE (Q9D892) Inosine triphosphate pyrophosphatase (EC 3.6... | 29 | 5.8 | 4 | TBG_RETFI (P54405) Tubulin gamma chain (Gamma tubulin) | 28 | 7.6 |
|---|
>HRPH_PSESY (Q01723) Hypersensitivity response secretion protein hrpH precursor| Length = 701 Score = 29.6 bits (65), Expect = 3.4 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -1 Query: 335 CGGNQSWRRW*LVEDRLWFQPGHPSDHYHHPRSPRVDKVEKQQR 204 CGG W W QPG S+ Y R P++ K+ K+ R Sbjct: 651 CGGR--WVIGVAAWPHAWLQPGEESEVYIAVRQPQISKMAKESR 692
>SYG_STRCO (Q9L2H9) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA| ligase) (GlyRS) Length = 460 Score = 29.3 bits (64), Expect = 4.4 Identities = 10/23 (43%), Positives = 16/23 (69%), Gaps = 5/23 (21%) Frame = -2 Query: 436 FFLRPNKDSKYRKY-----WNWY 383 FF++P +D K+++Y WNWY Sbjct: 216 FFVKPGEDEKWQEYWMEQRWNWY 238
>ITPA_MOUSE (Q9D892) Inosine triphosphate pyrophosphatase (EC 3.6.1.19)| (ITPase) (Inosine triphosphatase) Length = 198 Score = 28.9 bits (63), Expect = 5.8 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +2 Query: 164 NPNQA*LVCRRRRTAVVFPPCPHEDFEGDDSDQKDGQVETIADLPRVTSASNFDSH 331 +P+Q L+ R + + + P DF D Q DG +T A++P+ S N SH Sbjct: 124 DPSQPVLLFRGQTSGQIVMPRGSRDFGWDPCFQPDGYEQTYAEMPK--SEKNTISH 177
>TBG_RETFI (P54405) Tubulin gamma chain (Gamma tubulin)| Length = 478 Score = 28.5 bits (62), Expect = 7.6 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = -2 Query: 418 KDSKYRKYWNWYHHWVGRLVLFFAAVNIVVGIKVGGAGNSWKIGY 284 ++S+++ WN N+ + + GGAGN+W +GY Sbjct: 78 QESEFKNLWN--------------PENVYIDSQGGGAGNNWAVGY 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,447,272 Number of Sequences: 219361 Number of extensions: 1130355 Number of successful extensions: 3226 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3224 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)