| Clone Name | rbast02d08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HN_PI4HA (P21526) Hemagglutinin-neuraminidase (EC 3.2.1.18) | 30 | 1.4 | 2 | JIL1_DROME (Q9V3I5) Chromosomal serine/threonine-protein kinase ... | 30 | 1.8 | 3 | ARFG_ARATH (P93022) Auxin response factor 7 (Non-phototropic hyp... | 28 | 6.8 | 4 | MUC15_HUMAN (Q8N387) Mucin-15 precursor | 27 | 8.9 |
|---|
>HN_PI4HA (P21526) Hemagglutinin-neuraminidase (EC 3.2.1.18)| Length = 573 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 182 RDRLPLSAPKNHFPNRKQSRYTNFLI 259 +D LPLS P FP+ KQ+ YT F + Sbjct: 476 QDILPLSYPNTAFPHLKQAYYTGFYL 501
>JIL1_DROME (Q9V3I5) Chromosomal serine/threonine-protein kinase JIL-1 (EC| 2.7.11.1) Length = 1207 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +3 Query: 165 LLHSSPETGFRSPRQKITFRTENNLVIPTS 254 L+ PET FR PR + RTE+ LV P S Sbjct: 1025 LIPVEPETTFRRPRTRQQRRTESQLVQPVS 1054
>ARFG_ARATH (P93022) Auxin response factor 7 (Non-phototropic hypocotyl 4)| (Protein BIPOSTO) (Auxin-responsive protein IAA21/IAA23/IAA25) Length = 1164 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 130 HHITDEIISGSRCSTQAQRPASALRAKKSLSEQKTISLYQ 249 HH+ +++SGS S+ P+S+L +Q++ L Q Sbjct: 632 HHLQPQLVSGSMASSVITPPSSSLNQSFQQQQQQSKQLQQ 671
>MUC15_HUMAN (Q8N387) Mucin-15 precursor| Length = 334 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +2 Query: 167 APLKPRDRLPLSAPKNHFPNRKQSRYTNFLI---IKLPDVSTI 286 AP+ D LP+SA N P +T L+ +K PD S+I Sbjct: 124 APIADEDLLPISAHPNATPALSSENFTWSLVNDTVKTPDNSSI 166 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,705,018 Number of Sequences: 219361 Number of extensions: 584945 Number of successful extensions: 1210 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1207 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1210 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)