| Clone Name | rbast02b06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AROC_ERWCT (Q6D2M6) Chorismate synthase (EC 4.2.3.5) (5-enolpyru... | 29 | 7.2 | 2 | VL1_HPV51 (P26536) Major capsid protein L1 | 28 | 9.4 |
|---|
>AROC_ERWCT (Q6D2M6) Chorismate synthase (EC 4.2.3.5)| (5-enolpyruvylshikimate-3-phosphate phospholyase) Length = 361 Score = 28.9 bits (63), Expect = 7.2 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 435 EAADQVPQGYGAQADAGFRGHAASTFEGKARQEWYLG 325 E DQ Q YGA D GHA T+E K Q Y G Sbjct: 86 ENTDQRSQDYGAIKDVFRPGHADYTYEQKYGQRDYRG 122
>VL1_HPV51 (P26536) Major capsid protein L1| Length = 504 Score = 28.5 bits (62), Expect = 9.4 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 200 NLDLSSSKSSTIPCLTPSNLRSYIR 274 NL +S++ ++ P TPSN + YIR Sbjct: 341 NLTISTATAAVSPTFTPSNFKQYIR 365 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,676,811 Number of Sequences: 219361 Number of extensions: 1306068 Number of successful extensions: 3726 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3724 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)