| Clone Name | rbast02b05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CYB5_ORYSA (P49100) Cytochrome b5 | 92 | 4e-19 | 2 | CYB52_ARATH (O48845) Probable cytochrome b5 isoform 2 | 87 | 2e-17 | 3 | CYB5S_TOBAC (P49099) Cytochrome b5, seed isoform | 77 | 2e-14 | 4 | CYB5_TOBAC (P49098) Cytochrome b5 | 76 | 4e-14 | 5 | CYB5_CUSRE (P49097) Cytochrome b5 | 74 | 1e-13 | 6 | CYB51_ARATH (Q42342) Cytochrome b5 isoform 1 | 70 | 2e-12 | 7 | CYB5_BRAOB (P40934) Cytochrome b5 | 69 | 4e-12 | 8 | CYB5_BOROF (O04354) Cytochrome b5 | 69 | 4e-12 | 9 | ITIH3_HUMAN (Q06033) Inter-alpha-trypsin inhibitor heavy chain H... | 29 | 5.3 |
|---|
>CYB5_ORYSA (P49100) Cytochrome b5| Length = 137 Score = 92.4 bits (228), Expect = 4e-19 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = -2 Query: 425 KVKYMPPKQPHYNQDKTPEFIIKILQFLVPLAILGLAVPVRIYTKSES 282 + KY+PPKQPHYNQDKTPEFIIKILQFLVPLAILGLAV +RIYTKSES Sbjct: 89 RTKYVPPKQPHYNQDKTPEFIIKILQFLVPLAILGLAVAIRIYTKSES 136
>CYB52_ARATH (O48845) Probable cytochrome b5 isoform 2| Length = 134 Score = 86.7 bits (213), Expect = 2e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -2 Query: 425 KVKYMPPKQPHYNQDKTPEFIIKILQFLVPLAILGLAVPVRIYTKS 288 KVKY PPKQPHYNQDKT EFIIK+LQFLVPLAILGLAV +RIYTKS Sbjct: 88 KVKYTPPKQPHYNQDKTSEFIIKLLQFLVPLAILGLAVGIRIYTKS 133
>CYB5S_TOBAC (P49099) Cytochrome b5, seed isoform| Length = 135 Score = 77.0 bits (188), Expect = 2e-14 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -2 Query: 425 KVKYMPPKQPHYNQDKTPEFIIKILQFLVPLAILGLAVPVRIYTKSES 282 KVKY PPKQPHYNQDKT EFI+K+LQFLVPL ILG+A V YTK + Sbjct: 88 KVKYTPPKQPHYNQDKTTEFIVKLLQFLVPLIILGVAFGVHFYTKQSA 135
>CYB5_TOBAC (P49098) Cytochrome b5| Length = 136 Score = 75.9 bits (185), Expect = 4e-14 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = -2 Query: 425 KVKYMPPKQPHYNQDKTPEFIIKILQFLVPLAILGLAVPVRIYTKSES 282 K KY PP QPHYNQDKT EF++K+LQFLVPL ILG+A +R YTK S Sbjct: 88 KTKYTPPNQPHYNQDKTSEFVVKLLQFLVPLIILGVAFGIRFYTKQSS 135
>CYB5_CUSRE (P49097) Cytochrome b5| Length = 135 Score = 73.9 bits (180), Expect = 1e-13 Identities = 34/48 (70%), Positives = 38/48 (79%) Frame = -2 Query: 425 KVKYMPPKQPHYNQDKTPEFIIKILQFLVPLAILGLAVPVRIYTKSES 282 K Y PPKQP YNQDKTP+FIIK+LQFLVPL ILG+AV +R Y K S Sbjct: 87 KTSYTPPKQPLYNQDKTPQFIIKLLQFLVPLIILGVAVGIRFYKKQSS 134
>CYB51_ARATH (Q42342) Cytochrome b5 isoform 1| Length = 134 Score = 70.5 bits (171), Expect = 2e-12 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -2 Query: 416 YMPPKQPHYNQDKTPEFIIKILQFLVPLAILGLAVPVRIYTKSE 285 Y+ P+QP YNQDKTPEFIIKILQFLVP+ ILGLA+ VR YTK + Sbjct: 91 YVAPQQPAYNQDKTPEFIIKILQFLVPILILGLALVVRHYTKKD 134
>CYB5_BRAOB (P40934) Cytochrome b5| Length = 134 Score = 69.3 bits (168), Expect = 4e-12 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -2 Query: 416 YMPPKQPHYNQDKTPEFIIKILQFLVPLAILGLAVPVRIYTKSE 285 Y+ P QP YNQDKTPEF+IKILQFLVP+ ILGLA+ VR YTK E Sbjct: 91 YVAPVQPAYNQDKTPEFMIKILQFLVPILILGLALVVRQYTKKE 134
>CYB5_BOROF (O04354) Cytochrome b5| Length = 132 Score = 69.3 bits (168), Expect = 4e-12 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = -2 Query: 425 KVKYMPPKQPHYNQDKTPEFIIKILQFLVPLAILGLAVPVRIYTKSES 282 +VKY PPKQP YN DKT EF+IK+LQFLVPL IL A+ +R YTKS + Sbjct: 85 QVKYTPPKQPLYNPDKTREFVIKLLQFLVPLVILAGAIGIRFYTKSSA 132
>ITIH3_HUMAN (Q06033) Inter-alpha-trypsin inhibitor heavy chain H3 precursor| (ITI heavy chain H3) (Inter-alpha-inhibitor heavy chain 3) (Serum-derived hyaluronan-associated protein) (SHAP) Length = 885 Score = 28.9 bits (63), Expect = 5.3 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 416 YMPPKQPHYNQDKTPEFIIKI 354 Y PP+ P+Y D P FII+I Sbjct: 634 YQPPQNPYYYVDGDPHFIIQI 654 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,792,135 Number of Sequences: 219361 Number of extensions: 1008579 Number of successful extensions: 2074 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2039 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2074 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)