| Clone Name | rbast02a08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OXAA_CLOAB (Q97CW0) Membrane protein oxaA | 30 | 4.0 |
|---|
>OXAA_CLOAB (Q97CW0) Membrane protein oxaA| Length = 254 Score = 29.6 bits (65), Expect = 4.0 Identities = 15/61 (24%), Positives = 29/61 (47%) Frame = +3 Query: 108 FNRTKLEPISPSILTIFCYRLAKLVVH*HPSVHTPGVGWVYIHNLGCETTGTRVHRFTRW 287 + + P +L I Y + + + S+H G+G+++IH+L + T F+ W Sbjct: 91 YKEKNVNPFGGCLLLIIQYPILIALYYVFYSLHIKGIGFLWIHDLSQKAT------FSNW 144 Query: 288 T 290 T Sbjct: 145 T 145 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,200,520 Number of Sequences: 219361 Number of extensions: 1685347 Number of successful extensions: 3858 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3748 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3858 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)