| Clone Name | rbast01h08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YHJ5_YEAST (P38769) Hypothetical 72.3 kDa protein in SLT2-PUT2 i... | 28 | 7.3 |
|---|
>YHJ5_YEAST (P38769) Hypothetical 72.3 kDa protein in SLT2-PUT2 intergenic| region Length = 630 Score = 27.7 bits (60), Expect = 7.3 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -2 Query: 327 VLPFRATSPRTRVVFFSSFYNTRTDDMSSLCGPVI 223 +L R TSP R +F N D SLC P I Sbjct: 478 ILSVRNTSPDERYLFLHRIINASKDTCLSLCKPFI 512 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,740,624 Number of Sequences: 219361 Number of extensions: 397255 Number of successful extensions: 812 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 812 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)