| Clone Name | rbast01e12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYL_BUCAP (Q8K9B9) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine-... | 29 | 2.5 | 2 | RS6_NITOC (Q3JEJ6) 30S ribosomal protein S6 | 29 | 3.3 | 3 | IGA4_HAEIN (P45386) Immunoglobulin A1 protease precursor (EC 3.4... | 28 | 4.3 | 4 | TMEM8_MOUSE (Q9ESN3) Transmembrane protein 8 precursor (M83 prot... | 28 | 5.6 | 5 | Y1880_SYNY3 (P74125) Hypothetical UPF0047 protein sll1880 | 28 | 7.3 |
|---|
>SYL_BUCAP (Q8K9B9) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 861 Score = 29.3 bits (64), Expect = 2.5 Identities = 20/75 (26%), Positives = 37/75 (49%) Frame = +2 Query: 2 PGESQQFWHLAPSHNSNVHRFLVKN*EHKPPQGLHRKFGNHTKVTQHGKKKIPKNGR*YR 181 PG +Q W+ + HN + ++++KN ++K Q LH F + + + N Y Sbjct: 339 PGHNQNDWNFSIKHNLKI-KYVIKNKKYKNTQ-LHNLFTTEKGILYNSGE---FNNLNYH 393 Query: 182 NDTVILKDLLIQIRI 226 N T +K L++ +I Sbjct: 394 NATEKIKKTLLKKKI 408
>RS6_NITOC (Q3JEJ6) 30S ribosomal protein S6| Length = 156 Score = 28.9 bits (63), Expect = 3.3 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 176 YRNDTVILKDLLIQIRIAITNKKPLVKGNRAKQKGKQGY 292 +R + +L+D++I+ AIT PL KG ++ G +GY Sbjct: 78 FRFNDAVLRDMVIRREEAITETSPLAKG---EESGGRGY 113
>IGA4_HAEIN (P45386) Immunoglobulin A1 protease precursor (EC 3.4.21.72) (IGA1| protease) Length = 1849 Score = 28.5 bits (62), Expect = 4.3 Identities = 27/103 (26%), Positives = 42/103 (40%), Gaps = 1/103 (0%) Frame = +2 Query: 5 GESQQFWHLAPSHNSNVHRFLVKN*EHKPPQGLHRKFGNH-TKVTQHGKKKIPKNGR*YR 181 GES + W + R ++ + ++ G + FG TK TQ+GK + NG+ + Sbjct: 631 GESNENWLYMGRTSDEAKRNVMNHINNERMNGFNGYFGEEETKATQNGKLNVTFNGKSDQ 690 Query: 182 NDTVILKDLLIQIRIAITNKKPLVKGNRAKQKGKQGYPGRNTP 310 N R +T L G+ +KG GR TP Sbjct: 691 N------------RFLLTGGTNL-NGDLNVEKGTLFLSGRPTP 720
>TMEM8_MOUSE (Q9ESN3) Transmembrane protein 8 precursor (M83 protein)| Length = 769 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 240 LFVIAILI*ISRSFNITVSFLYYRPFFGIFFFPC 139 +F+ I I + RSF + S +Y FF F+ C Sbjct: 555 MFLAPIAISLHRSFLVEASVYFYTMFFSTFYHAC 588
>Y1880_SYNY3 (P74125) Hypothetical UPF0047 protein sll1880| Length = 147 Score = 27.7 bits (60), Expect = 7.3 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +2 Query: 155 IPKNGR*YRNDTVILKDLLIQIRIAITNKK---PLVKG 259 +P++GR YR+ T L D+ IR A+T P+V G Sbjct: 78 VPEDGRRYRHSTEGLDDMPAHIRSALTKTSEHIPIVNG 115 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,559,685 Number of Sequences: 219361 Number of extensions: 1055050 Number of successful extensions: 2496 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2490 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)