| Clone Name | rbart61f10 |
|---|---|
| Clone Library Name | barley_pub |
>P2RY5_MOUSE (Q8BMC0) P2Y purinoceptor 5 (P2Y5) (Purinergic receptor 5)| Length = 344 Score = 30.8 bits (68), Expect = 0.91 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 6/46 (13%) Frame = +2 Query: 104 PLVQNITHADMIINTINPKFTCKECPPGRAR------THTLCFCFC 223 PL+ N+T + M++ T+N T + + H + FCFC Sbjct: 196 PLILNVTCSSMVLRTLNKPVTLSRSKMNKTKVLKMIFVHLVIFCFC 241
>FBN1_BOVIN (P98133) Fibrillin-1 precursor (MP340)| Length = 2871 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +2 Query: 134 MIINTINPKFTCKECPPGRARTHTLC 211 + +NTI FTCK CPPG + HT C Sbjct: 2499 LCVNTIG-SFTCK-CPPGFTQHHTAC 2522
>FBN1_MOUSE (Q61554) Fibrillin-1 precursor| Length = 2871 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +2 Query: 134 MIINTINPKFTCKECPPGRARTHTLC 211 + +NTI FTCK CPPG + HT C Sbjct: 2499 LCVNTIGG-FTCK-CPPGFTQHHTAC 2522
>P2RY5_CHICK (P32250) P2Y purinoceptor 5 (P2Y5) (Purinergic receptor 5) (6H1)| Length = 308 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 6/46 (13%) Frame = +2 Query: 104 PLVQNITHADMIINTINPKFTCKECPPGRAR------THTLCFCFC 223 PL+ N+T + M++ T+N T + + H + FCFC Sbjct: 193 PLILNVTCSTMVLRTLNKPLTLSRNKLSKKKVLKMIFVHLVIFCFC 238
>FBN1_HUMAN (P35555) Fibrillin-1 precursor| Length = 2871 Score = 28.9 bits (63), Expect = 3.5 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +2 Query: 134 MIINTINPKFTCKECPPGRARTHTLC 211 + +NTI FTCK CPPG + HT C Sbjct: 2499 LCVNTIGG-FTCK-CPPGFTQHHTSC 2522
>S23A2_MOUSE (Q9EPR4) Solute carrier family 23 member 2 (Sodium-dependent| vitamin C transporter 2) (mSVCT2) (Na(+)/L-ascorbic acid transporter 2) (Yolk sac permease-like molecule 2) Length = 647 Score = 28.9 bits (63), Expect = 3.5 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +2 Query: 17 VEMNRQFTTNTLAYSFAHAILLCIYRPPNPLVQNITHADMIINTI 151 +++N L +S ++L Y NPLV IT D I+N + Sbjct: 506 IDLNSSRNLFVLGFSIFFGLVLPSYLRQNPLVTGITGIDQILNVL 550
>P2RY5_HUMAN (P43657) P2Y purinoceptor 5 (P2Y5) (Purinergic receptor 5) (RB| intron encoded G-protein coupled receptor) Length = 344 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/46 (26%), Positives = 21/46 (45%), Gaps = 6/46 (13%) Frame = +2 Query: 104 PLVQNITHADMIINTINPKFTCKECPPGRAR------THTLCFCFC 223 PL+ N+T + M++ T+ T + + H + FCFC Sbjct: 196 PLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCFC 241
>FBN2_MOUSE (Q61555) Fibrillin-2 precursor| Length = 2907 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 134 MIINTINPKFTCKECPPGRARTHTLC 211 + +NT+ FTCK CPPG + HT C Sbjct: 2539 LCVNTLGG-FTCK-CPPGFTQHHTAC 2562
>FBN2_HUMAN (P35556) Fibrillin-2 precursor| Length = 2911 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 134 MIINTINPKFTCKECPPGRARTHTLC 211 + +NT+ FTCK CPPG + HT C Sbjct: 2545 LCVNTLGG-FTCK-CPPGFTQHHTAC 2568
>FBN1_PIG (Q9TV36) Fibrillin-1 precursor| Length = 2871 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 134 MIINTINPKFTCKECPPGRARTHTLC 211 + +NTI F CK CPPG + HT C Sbjct: 2499 LCVNTIG-SFACK-CPPGFTQHHTAC 2522
>FBN3_HUMAN (Q75N90) Fibrillin-3 precursor| Length = 2809 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 134 MIINTINPKFTCKECPPGRARTHTLCF 214 + +NT+ FTC+ CPPG + H CF Sbjct: 2460 LCVNTVGA-FTCR-CPPGFTQHHQACF 2484 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,321,047 Number of Sequences: 219361 Number of extensions: 684740 Number of successful extensions: 1886 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1886 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)