| Clone Name | rbart61e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MSC3_CANGA (Q6FX33) Meiotic sister-chromatid recombination prote... | 32 | 0.40 | 2 | MNN11_YEAST (P46985) Probable alpha-1,6-mannosyltransferase MNN1... | 29 | 3.4 | 3 | BCE1_HUMAN (O60756) Protein BCE-1 | 28 | 5.8 | 4 | EFTU_CHLTR (P26622) Elongation factor Tu (EF-Tu) | 28 | 5.8 | 5 | STP7_ARATH (O04249) Sugar transport protein 7 (Hexose transporte... | 28 | 5.8 |
|---|
>MSC3_CANGA (Q6FX33) Meiotic sister-chromatid recombination protein 3| Length = 834 Score = 32.0 bits (71), Expect = 0.40 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +3 Query: 66 NKSAFTQHRIRIPK-YGGRMMLLYVARTRIYSVGSPTDTRFTRARSTFFSSAPAAGR 233 NK A + +P+ YGG+ + A IY+ +P T +R+ S S PAA R Sbjct: 23 NKPAVDSSKYYVPREYGGKRLSASAAAAAIYTNPNPNATGVSRSYSLMHSYNPAAAR 79
>MNN11_YEAST (P46985) Probable alpha-1,6-mannosyltransferase MNN11 (EC 2.4.1.-)| (Mannan polymerase II complex MNN11 subunit) (M-Pol II subunit MNN11) Length = 422 Score = 28.9 bits (63), Expect = 3.4 Identities = 17/79 (21%), Positives = 30/79 (37%), Gaps = 4/79 (5%) Frame = +3 Query: 9 KPSISGDTKMDRQTNKQINNKSAFTQHRIRIPKY----GGRMMLLYVARTRIYSVGSPTD 176 KP G T R Q N+ F Q++ K+ + +LY R Y + Sbjct: 4 KPRTKGKTYSSRSVGSQWFNRLGFKQNKYGTCKFLSIITAFVFILYFFSNRFYPISRSAG 63 Query: 177 TRFTRARSTFFSSAPAAGR 233 ++ + + + PA+ R Sbjct: 64 ASYSPSHGLYINEIPASSR 82
>BCE1_HUMAN (O60756) Protein BCE-1| Length = 84 Score = 28.1 bits (61), Expect = 5.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 78 MLICYLFVCLFVCPFWCPLKWT 13 M C+L++ F C W LKWT Sbjct: 39 MRTCFLYLRFFPCLSWMSLKWT 60
>EFTU_CHLTR (P26622) Elongation factor Tu (EF-Tu)| Length = 393 Score = 28.1 bits (61), Expect = 5.8 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 176 HTVYTCALYILQLRSGGR 229 HT + CA+Y+LQ GGR Sbjct: 301 HTQFKCAVYVLQKEEGGR 318
>STP7_ARATH (O04249) Sugar transport protein 7 (Hexose transporter 7)| Length = 513 Score = 28.1 bits (61), Expect = 5.8 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = -3 Query: 84 G*MLICYLFVCLFVCPF---WCPLKWT 13 G +I +F+CLFV F W PL WT Sbjct: 384 GYSVIVVIFICLFVVAFGWSWGPLGWT 410 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,405,121 Number of Sequences: 219361 Number of extensions: 840667 Number of successful extensions: 2044 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1999 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2042 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)