| Clone Name | rbart61d03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AT11C_HUMAN (Q8NB49) Probable phospholipid-transporting ATPase I... | 30 | 1.1 | 2 | AT11C_MOUSE (Q9QZW0) Probable phospholipid-transporting ATPase 1... | 30 | 1.9 | 3 | RT03_ACACA (P46754) Mitochondrial ribosomal protein S3 | 28 | 5.4 | 4 | M130_STRPU (P08472) Mesenchyme-specific cell surface glycoprotei... | 27 | 9.2 |
|---|
>AT11C_HUMAN (Q8NB49) Probable phospholipid-transporting ATPase IG (EC 3.6.3.1)| (ATPase class I type 11C) (ATPase IG) (ATPase IQ) (ATPase class VI type 11C) Length = 1132 Score = 30.4 bits (67), Expect = 1.1 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = -2 Query: 103 YFFFLRIPRYITTWVYVLLCLFVSLFARV 17 YF F ++ ++TW+ ++L +F+SLF + Sbjct: 1057 YFVFAQMLSSVSTWLAIILLIFISLFPEI 1085
>AT11C_MOUSE (Q9QZW0) Probable phospholipid-transporting ATPase 11C (EC 3.6.3.1)| (Fragment) Length = 347 Score = 29.6 bits (65), Expect = 1.9 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = -2 Query: 103 YFFFLRIPRYITTWVYVLLCLFVSLFARV 17 YF F ++ ++TW+ ++L +F+SLF + Sbjct: 285 YFVFAQMLCSVSTWLAIILLIFISLFPEI 313
>RT03_ACACA (P46754) Mitochondrial ribosomal protein S3| Length = 298 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -2 Query: 181 FGRLITLVNLFPVLCVMRDV*CSAISYFFFLRIPRYITTW 62 F R L +F + +V + IS FFF+R+ +Y T W Sbjct: 169 FSRSSFLSKIFIIGLSKMNVNANIISEFFFIRLTQYYTIW 208
>M130_STRPU (P08472) Mesenchyme-specific cell surface glycoprotein precursor| (MSP130) Length = 779 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 35 NK*TKQYINPSGNVTWNTKEKKVGNGRALHVTHHT 139 N TK+Y+NP G +T V NG + + + T Sbjct: 202 NNYTKKYVNPEGTITTVRLAGSVSNGPSQQIVNTT 236 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,778,856 Number of Sequences: 219361 Number of extensions: 715085 Number of successful extensions: 1622 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1622 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)