| Clone Name | rbart60h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VG55_ICHV1 (Q00153) Hypothetical gene 55 protein | 30 | 1.2 | 2 | RNP3_PYRFU (Q8TZS0) Ribonuclease P protein component 3 (EC 3.1.2... | 29 | 2.6 | 3 | PHO4_NEUCR (P15710) Phosphate-repressible phosphate permease | 28 | 5.8 | 4 | ODP1_BUCAI (P57301) Pyruvate dehydrogenase E1 component (EC 1.2.... | 27 | 9.9 |
|---|
>VG55_ICHV1 (Q00153) Hypothetical gene 55 protein| Length = 388 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 112 AKLVQIMLTVDFYVLHIGRQVLCQILQKEVLRQFP 216 A+ + LTV ++ +GR++ C ++ K RQFP Sbjct: 313 ARTQALRLTVYAHMARLGREIQCSVVTKVTFRQFP 347
>RNP3_PYRFU (Q8TZS0) Ribonuclease P protein component 3 (EC 3.1.26.5) (RNase P| component 3) Length = 214 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -1 Query: 322 HGL*RMQNLQGVALSKKLVPKLHGNP 245 H L RM N +GVAL L P LH NP Sbjct: 117 HVLARMMNKRGVALGFSLRPLLHQNP 142
>PHO4_NEUCR (P15710) Phosphate-repressible phosphate permease| Length = 590 Score = 28.1 bits (61), Expect = 5.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 81 TNARLGVNLCSGIWNTI 31 T A +GV LCSG W TI Sbjct: 534 TGATVGVGLCSGTWRTI 550
>ODP1_BUCAI (P57301) Pyruvate dehydrogenase E1 component (EC 1.2.4.1)| Length = 887 Score = 27.3 bits (59), Expect = 9.9 Identities = 21/57 (36%), Positives = 28/57 (49%) Frame = -1 Query: 304 QNLQGVALSKKLVPKLHGNPRYFSLVGAGLEIDEALLFAKFGKVLVCQYAKHRSQQL 134 Q + G+ LS PKL N F V GL A+ AKF K L + K+ S+Q+ Sbjct: 168 QEVDGIGLSSYPHPKLMPNFWQFPTVSMGLGPLCAIYQAKFLKYLHNRELKNTSKQI 224 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,751,901 Number of Sequences: 219361 Number of extensions: 878400 Number of successful extensions: 2365 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2365 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)