| Clone Name | rbart60f05 |
|---|---|
| Clone Library Name | barley_pub |
>UPTG_MAIZE (P80607) Alpha-1,4-glucan-protein synthase [UDP-forming] (EC| 2.4.1.112) (UDP-glucose:protein transglucosylase) (UPTG) (Amylogenin) (Golgi-associated protein se-wap41) Length = 364 Score = 66.6 bits (161), Expect = 1e-11 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 361 QVREKLGRIDPYFLKLADAMVTWIEAWDELNPS 263 QV+EKLG IDPYF+KL DAMVTWIEAWDELNPS Sbjct: 322 QVKEKLGTIDPYFVKLGDAMVTWIEAWDELNPS 354
>UPTG2_SOLTU (Q8RU27) Alpha-1,4-glucan-protein synthase [UDP-forming] 2 (EC| 2.4.1.112) (UDP-glucose:protein transglucosylase 2) (UPTG 2) Length = 366 Score = 64.3 bits (155), Expect = 7e-11 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -2 Query: 364 EQVREKLGRIDPYFLKLADAMVTWIEAWDELNPS 263 +QV+EKL IDPYF KLADAMVTWIEAWDELNP+ Sbjct: 315 KQVKEKLSTIDPYFTKLADAMVTWIEAWDELNPT 348
>UPTG_PEA (O04300) Alpha-1,4-glucan-protein synthase [UDP-forming] (EC| 2.4.1.112) (UDP-glucose:protein transglucosylase) (UPTG) (Reversibly glycosylated polypeptide) Length = 364 Score = 63.5 bits (153), Expect = 1e-10 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -2 Query: 364 EQVREKLGRIDPYFLKLADAMVTWIEAWDELN 269 +QV+EKLG IDPYF+KLADAMVTW+EAWDE+N Sbjct: 314 KQVKEKLGTIDPYFIKLADAMVTWVEAWDEIN 345
>UPTG1_SOLTU (Q9SC19) Alpha-1,4-glucan-protein synthase [UDP-forming] 1 (EC| 2.4.1.112) (UDP-glucose:protein transglucosylase 1) (UPTG 1) Length = 365 Score = 56.6 bits (135), Expect = 1e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 364 EQVREKLGRIDPYFLKLADAMVTWIEAWDELN 269 +QV++KL IDPYF KL +AMVTWIEAWDELN Sbjct: 311 KQVKKKLSSIDPYFTKLGEAMVTWIEAWDELN 342
>FBIC_MYCPA (Q73WP9) FO synthase (EC 2.5.1.-)| (7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase) Length = 867 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -1 Query: 266 ICYS*CRCCCW-ERQGSSQVASLGSQECMVTAW 171 ICY+ CR C + +R+G + SL ++E AW Sbjct: 568 ICYTGCRFCAFAQRKGDADAYSLSTEEVADRAW 600
>FBIC_MYCLE (Q9CBX6) FO synthase (EC 2.5.1.-)| (7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase) Length = 863 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -1 Query: 266 ICYS*CRCCCW-ERQGSSQVASLGSQECMVTAW 171 ICY+ CR C + +R+G + SL +E AW Sbjct: 564 ICYTGCRFCAFAQRKGDTDAYSLSREEVAERAW 596
>FBIC_NOCFA (Q5YQD7) FO synthase (EC 2.5.1.-)| (7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase) Length = 865 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -1 Query: 266 ICYS*CRCCCW-ERQGSSQVASLGSQECMVTAW 171 ICY+ CR C + +R+G + +L ++E AW Sbjct: 557 ICYTGCRFCAFAQRKGDADAFTLSTEEVADRAW 589
>NOTC1_RAT (Q07008) Neurogenic locus notch homolog protein 1 precursor (Notch 1)| [Contains: Notch 1 extracellular truncation; Notch 1 intracellular domain] Length = 2531 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 185 YTLDFPS*LLGCCLAVPSSSNGIRSSRWVQLVPGLDPG 298 +T+ P+ L G C +P NG+ S++ L PG+ PG Sbjct: 2286 FTVGAPASLNGQCEWLPRLQNGMVPSQYNPLRPGVTPG 2323
>NOTC1_MOUSE (Q01705) Neurogenic locus notch homolog protein 1 precursor (Notch 1)| (Motch A) (mT14) (p300) [Contains: Notch 1 extracellular truncation; Notch 1 intracellular domain] Length = 2531 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 185 YTLDFPS*LLGCCLAVPSSSNGIRSSRWVQLVPGLDPG 298 +T+ P+ L G C +P NG+ S++ L PG+ PG Sbjct: 2286 FTVGAPASLNGQCEWLPRLQNGMVPSQYNPLRPGVTPG 2323
>NOSZ_BRUSU (Q8FX16) Nitrous-oxide reductase precursor (EC 1.7.99.6) (N(2)OR)| (N2O reductase) Length = 639 Score = 27.7 bits (60), Expect = 7.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 109 WWFFCSWIRICYHLHNSRQ 53 WW++CSW C+ +H Q Sbjct: 613 WWYYCSW--FCHAMHMEMQ 629
>NOSZ_BRUME (Q8YBC6) Nitrous-oxide reductase precursor (EC 1.7.99.6) (N(2)OR)| (N2O reductase) Length = 639 Score = 27.7 bits (60), Expect = 7.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 109 WWFFCSWIRICYHLHNSRQ 53 WW++CSW C+ +H Q Sbjct: 613 WWYYCSW--FCHAMHMEMQ 629
>SF3B2_HUMAN (Q13435) Splicing factor 3B subunit 2 (Spliceosome-associated| protein 145) (SAP 145) (SF3b150) (Pre-mRNA splicing factor SF3b 145 kDa subunit) Length = 872 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 364 EQVREKLGRIDPYFLKLADAMVTW 293 E+VR K+G+ID + KL DA W Sbjct: 532 EKVRPKMGKIDIDYQKLHDAFFKW 555
>RPOC2_CHLRE (Q7PCJ6) DNA-directed RNA polymerase beta'' chain (EC 2.7.7.6)| (PEP) (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 3120 Score = 27.3 bits (59), Expect = 9.3 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 10 NKRCLISQNYMINIIVLNYVNDNKSLSSYKRTTSIT*KNY 129 NK C + + N L Y+N +K L S R S T NY Sbjct: 52 NKTCNTNSGILYNQYSLGYINMHKQLPSLIRNKSKTIGNY 91 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,948,097 Number of Sequences: 219361 Number of extensions: 687813 Number of successful extensions: 1467 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1462 length of database: 80,573,946 effective HSP length: 97 effective length of database: 59,295,929 effective search space used: 1423102296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)