| Clone Name | rbart60e11 |
|---|---|
| Clone Library Name | barley_pub |
>PIP21_ORYSA (Q8H5N9) Probable aquaporin PIP2.1 (Plasma membrane intrinsic| protein 2a) (PIP2a) (OsPIP2.1) Length = 290 Score = 45.4 bits (106), Expect = 4e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 306 YHQYILRAGAIKALGSFRSNA 244 YHQYILRAGAIKALGSFRSNA Sbjct: 270 YHQYILRAGAIKALGSFRSNA 290
>PIP27_ARATH (P93004) Aquaporin PIP2.7 (Plasma membrane intrinsic protein 3)| (Salt stress-induced major intrinsic protein) Length = 280 Score = 43.1 bits (100), Expect = 2e-04 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -2 Query: 306 YHQYILRAGAIKALGSFRSNA 244 YHQYILRA AIKALGSFRSNA Sbjct: 258 YHQYILRASAIKALGSFRSNA 278
>PIP26_ORYSA (Q7XLR1) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2.6) (OsPIP2.6) Length = 282 Score = 41.6 bits (96), Expect = 5e-04 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 306 YHQYILRAGAIKALGSFRSN 247 YHQYILRA AIKALGSFRSN Sbjct: 260 YHQYILRAAAIKALGSFRSN 279
>PIP1_ATRCA (P42767) Aquaporin PIP-type| Length = 282 Score = 41.2 bits (95), Expect = 7e-04 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 306 YHQYILRAGAIKALGSFRSN 247 YHQY+LRA AIKALGSFRSN Sbjct: 260 YHQYVLRAAAIKALGSFRSN 279
>PIP25_ARATH (Q9SV31) Probable aquaporin PIP2.5 (Plasma membrane intrinsic| protein 2d) (PIP2d) Length = 286 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = -2 Query: 306 YHQYILRAGAIKALGSFRS 250 YHQ++LRAGAIKALGSFRS Sbjct: 264 YHQFVLRAGAIKALGSFRS 282
>PIP28_ARATH (Q9ZVX8) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 3b) (PIP3b) Length = 278 Score = 39.3 bits (90), Expect = 0.003 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 306 YHQYILRAGAIKALGSFRSN 247 YHQYILRA AIKAL SFRSN Sbjct: 256 YHQYILRAAAIKALASFRSN 275
>PIP24_ARATH (Q9FF53) Probable aquaporin PIP2.4 (Plasma membrane intrinsic| protein 2.4) Length = 291 Score = 35.0 bits (79), Expect = 0.048 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 306 YHQYILRAGAIKALGSFRS 250 YHQ+ILRA AIKALGSF S Sbjct: 265 YHQFILRAAAIKALGSFGS 283
>PIP26_ARATH (Q9ZV07) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2e) (PIP2e) Length = 289 Score = 33.9 bits (76), Expect = 0.11 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -2 Query: 306 YHQYILRAGAIKALGSFRS 250 YHQ++LRAGA+KA GS RS Sbjct: 264 YHQFVLRAGAMKAYGSVRS 282
>PIP22_ORYSA (Q6K215) Probable aquaporin PIP2.2 (Plasma membrane intrinsic| protein 2.2) (OsPIP2.2) Length = 288 Score = 33.5 bits (75), Expect = 0.14 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 306 YHQYILRAGAIKALGSFRSNA 244 YHQY+LRA A K LGS+RSNA Sbjct: 269 YHQYVLRASAAK-LGSYRSNA 288
>PIP23_ARATH (P30302) Aquaporin PIP2.3 (Plasma membrane intrinsic protein 2c)| (PIP2c) (TMP2C) (RD28-PIP) (Water stress-induced tonoplast intrinsic protein) (WSI-TIP) Length = 285 Score = 33.1 bits (74), Expect = 0.18 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -2 Query: 306 YHQYILRAGAIKALGSFRSNA 244 YHQ++LRA K+LGSFRS A Sbjct: 263 YHQFVLRASGSKSLGSFRSAA 283
>PIP22_ARATH (P43287) Aquaporin PIP2.2 (Plasma membrane intrinsic protein 2b)| (PIP2b) (TMP2b) Length = 285 Score = 33.1 bits (74), Expect = 0.18 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -2 Query: 306 YHQYILRAGAIKALGSFRSNA 244 YHQ++LRA K+LGSFRS A Sbjct: 263 YHQFVLRASGSKSLGSFRSAA 283
>PIP21_ARATH (P43286) Aquaporin PIP2.1 (Plasma membrane intrinsic protein 2a)| (PIP2a) Length = 287 Score = 33.1 bits (74), Expect = 0.18 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -2 Query: 306 YHQYILRAGAIKALGSFRSNA 244 YHQ++LRA K+LGSFRS A Sbjct: 265 YHQFVLRASGSKSLGSFRSAA 285
>Q300_MOUSE (Q02722) Protein Q300| Length = 77 Score = 29.3 bits (64), Expect = 2.6 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 114 YLCVGSCICVCAQSCVPCVVIRSMGSLVLITPHSFSC 4 Y+CV C+CVC C + +S G+L + + C Sbjct: 26 YVCVCVCVCVCVCVCTLTCMCKSGGNLGCSSSGAIHC 62
>FPRB_MYCTU (P65528) Probable ferredoxin/ferredoxin--NADP reductase (EC| 1.18.1.2) (FNR) Length = 575 Score = 28.9 bits (63), Expect = 3.4 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 4/61 (6%) Frame = -2 Query: 237 VIHVMCMQD*SNGDLC---CVHPSKEKAAFATSRQ-FSWPLQWSCYLCVGSCICVCAQSC 70 VI C D S C C+HP+ ++ FATS + P+ +C C G+C+ C S Sbjct: 4 VITQSCCNDASCVFACPVNCIHPTPDEPGFATSEMLYIDPV--ACVDC-GACVTACPVSA 60 Query: 69 V 67 + Sbjct: 61 I 61
>FPRB_MYCBO (P65529) Probable ferredoxin/ferredoxin--NADP reductase (EC| 1.18.1.2) (FNR) Length = 575 Score = 28.9 bits (63), Expect = 3.4 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 4/61 (6%) Frame = -2 Query: 237 VIHVMCMQD*SNGDLC---CVHPSKEKAAFATSRQ-FSWPLQWSCYLCVGSCICVCAQSC 70 VI C D S C C+HP+ ++ FATS + P+ +C C G+C+ C S Sbjct: 4 VITQSCCNDASCVFACPVNCIHPTPDEPGFATSEMLYIDPV--ACVDC-GACVTACPVSA 60 Query: 69 V 67 + Sbjct: 61 I 61
>FAD6E_ARATH (P46313) Omega-6 fatty acid desaturase, endoplasmic reticulum (EC| 1.14.19.-) (Delta-12 desaturase) Length = 383 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 138 SWPLQWSCYLCVGSCICVCAQSC 70 +WPL W+C CV + I V A C Sbjct: 85 AWPLYWACQGCVLTGIWVIAHEC 107
>HDA3_ASHGO (Q758V8) HDA1 complex subunit 3 (Histone deacetylase complex 1| subunit 3) Length = 637 Score = 28.5 bits (62), Expect = 4.5 Identities = 22/85 (25%), Positives = 37/85 (43%), Gaps = 6/85 (7%) Frame = -1 Query: 283 RRHQGPRLLQEQRVTSYPCDVHARLKQWRPVLCPSIQRESR----FCNFSTVQLAAAMV- 119 RRH G + +Q+ T Y C H L +++R++R C TV A + Sbjct: 158 RRHDGQSIKTKQKKTRYACTCH--LVPSEAAKAIALERDTRLGLVICVDPTVDTRAPHIQ 215 Query: 118 -VLFMCRQLHMRMCPVMRAVCCNSV 47 +L ++ + R P +R NS+ Sbjct: 216 SILAQQQRKYGRTVPTIRVAVINSI 240
>PIP27_ORYSA (Q651D5) Probable aquaporin PIP2.7 (Plasma membrane intrinsic| protein 2.7) (OsPIP2.7) Length = 290 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -2 Query: 306 YHQYILRAGAIKALGSFRSNA 244 YH+ +LR A KAL SFRS + Sbjct: 267 YHKLVLRGEAAKALSSFRSTS 287
>HEPC1_SALSA (Q801Y3) Hepcidin-1 precursor| Length = 86 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 103 RQLHMRMCPVMRAVCCNSVHGIAC 32 RQ+H+ +C +CCN H I C Sbjct: 61 RQIHLSLC----GLCCNCCHNIGC 80
>MDL1_CANAL (P97998) ATP-dependent permease MDL1| Length = 685 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +1 Query: 127 QRPTELSRSCKSGFLFGWMDTAQVAIASILHAHHMDNSLRVAPEGAEGLDGA 282 Q P S + K LFG D I + L+ + N +R P+G + GA Sbjct: 523 QEPLLFSGTIKENILFGKEDATDEEINNALNLSYASNFVRHLPDGLDTKIGA 574 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,843,203 Number of Sequences: 219361 Number of extensions: 864622 Number of successful extensions: 2392 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 2330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2385 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)