| Clone Name | rbart60d06 |
|---|---|
| Clone Library Name | barley_pub |
>TIP11_ORYSA (P50156) Probable aquaporin TIP1.1 (Tonoplast intrinsic protein| 1.1) (OsTIP1.1) (rTIP1) Length = 250 Score = 80.9 bits (198), Expect = 7e-16 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFISRTHEQLPTTDY 256 W QWVYWVGPLIGGGLAGVIYE+LFIS THEQLPTTDY Sbjct: 212 WESQWVYWVGPLIGGGLAGVIYEVLFISHTHEQLPTTDY 250
>TIP1_MEDSA (P42067) Probable aquaporin TIP-type (Membrane channel protein 1)| (MsMCP1) Length = 249 Score = 74.3 bits (181), Expect = 7e-14 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFISRTHEQLPTTDY 256 W WVYW GPLIGGG+AG++YE+LFI+ THEQLPTTDY Sbjct: 211 WSNHWVYWAGPLIGGGIAGLVYEVLFINSTHEQLPTTDY 249
>TIP1_MEDTR (Q9FY14) Probable aquaporin TIP-type (MtAQP1)| Length = 250 Score = 74.3 bits (181), Expect = 7e-14 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFISRTHEQLPTTDY 256 W WVYW GPLIGGG+AG++YE+LFI+ THEQLPTTDY Sbjct: 212 WSNHWVYWAGPLIGGGIAGLVYEVLFINSTHEQLPTTDY 250
>TIP11_ARATH (P25818) Aquaporin TIP1.1 (Tonoplast intrinsic protein 1.1)| (Gamma-tonoplast intrinsic protein) (Gamma-TIP) (Aquaporin-TIP) (Tonoplast intrinsic protein, root-specific RB7) Length = 251 Score = 72.0 bits (175), Expect = 3e-13 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFISRTHEQLPTTDY 256 W WVYW GPL+GGG+AG+IYE+ FI+ THEQLPTTDY Sbjct: 213 WTNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQLPTTDY 251
>TIP12_ARATH (Q41963) Aquaporin TIP1.2 (Tonoplast intrinsic protein 1.2)| (Gamma-tonoplast intrinsic protein 2) (Gamma-TIP2) (Salt stress-induced tonoplast intrinsic protein) Length = 253 Score = 66.2 bits (160), Expect = 2e-11 Identities = 28/40 (70%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFI-SRTHEQLPTTDY 256 W WVYW GPLIGGGLAG+IY+ +FI HEQLPTTDY Sbjct: 214 WTNHWVYWAGPLIGGGLAGIIYDFVFIDENAHEQLPTTDY 253
>TIP12_ORYSA (Q94CS9) Probable aquaporin TIP1.2 (Tonoplast intrinsic protein| 1.2) (OsTIP1.2) Length = 252 Score = 56.2 bits (134), Expect = 2e-08 Identities = 21/40 (52%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFI-SRTHEQLPTTDY 256 W WVYW+GP +G +A +IY+++FI R H+QLPT DY Sbjct: 213 WDNHWVYWLGPFVGAAIAALIYDIIFIGQRPHDQLPTADY 252
>TIP41_ORYSA (Q75GA5) Probable aquaporin TIP4.1 (Tonoplast intrinsic protein| 4.1) (OsTIP4.1) Length = 251 Score = 54.7 bits (130), Expect = 5e-08 Identities = 22/35 (62%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLF-ISRTHEQL 271 W + W+YW+GPLIGG LAG++YE LF + RTHE L Sbjct: 212 WTHHWIYWLGPLIGGPLAGLVYESLFLVKRTHEPL 246
>TIP41_ARATH (O82316) Probable aquaporin TIP4.1 (Tonoplast intrinsic protein| 4.1) (Epsilon-tonoplast intrinsic protein) (Epsilon-TIP) Length = 249 Score = 53.1 bits (126), Expect = 2e-07 Identities = 24/38 (63%), Positives = 26/38 (68%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFISRTHEQLPTTD 259 W WVYWVGPLIGGGLAG IYE + I R H +P D Sbjct: 207 WTDHWVYWVGPLIGGGLAGFIYENVLIDRPH--VPVAD 242
>TIP43_ORYSA (Q9LWR2) Probable aquaporin TIP4.3 (Tonoplast intrinsic protein| 4.3) (OsTIP4.3) Length = 251 Score = 52.8 bits (125), Expect = 2e-07 Identities = 23/39 (58%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFISRT-HEQLPTTD 259 W W+YWVGPLIGG LAG++YE LF+ HE LP D Sbjct: 210 WADHWIYWVGPLIGGPLAGLVYEGLFMGPPGHEPLPRND 248
>TIP13_ARATH (O82598) Putative aquaporin TIP1.3 (Tonoplast intrinsic protein| 1.3) (Gamma-tonoplast intrinsic protein 3) (Gamma-TIP3) Length = 252 Score = 51.6 bits (122), Expect = 5e-07 Identities = 20/40 (50%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFI-SRTHEQLPTTDY 256 W WVYWVGP IG +A ++Y+ +FI S HE LP+ D+ Sbjct: 213 WTNHWVYWVGPFIGAAIAAIVYDTIFIGSNGHEPLPSNDF 252
>AQP_DROME (Q9V5Z7) Aquaporin| Length = 245 Score = 48.9 bits (115), Expect = 3e-06 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLF 295 W Y WVYWVGP+ GG LAG+IY L+F Sbjct: 206 WTYHWVYWVGPIAGGLLAGIIYRLIF 231
>TIP42_ORYSA (Q9LWR0) Probable aquaporin TIP4.2 (Tonoplast intrinsic protein| 4.2) (OsTIP4.2) Length = 251 Score = 48.1 bits (113), Expect = 5e-06 Identities = 22/40 (55%), Positives = 25/40 (62%), Gaps = 5/40 (12%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFI-----SRTHEQLP 268 W + WVYWVGPL GG LA V YELLF+ H+ LP Sbjct: 210 WAHHWVYWVGPLAGGPLAVVAYELLFMDVEDAGGAHQPLP 249
>TIP21_ARATH (Q41951) Aquaporin TIP2.1 (Tonoplast intrinsic protein 2.1)| (Delta-tonoplast intrinsic protein) (Delta-TIP) Length = 250 Score = 48.1 bits (113), Expect = 5e-06 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFI-SRTHEQLPTTDY 256 WVYWVGPLIGGGLAG+IY +F+ S H L + D+ Sbjct: 215 WVYWVGPLIGGGLAGLIYGNVFMGSSEHVPLASADF 250
>TIP2_TOBAC (P24422) Probable aquaporin TIP-type RB7-18C (Tonoplast intrinsic| protein, root-specific RB7-18C) (TobRB7) (RT-TIP) Length = 250 Score = 47.8 bits (112), Expect = 7e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRTHEQLPTTD 259 W+YW GPLIGGGLAG IY +FI H LPT++ Sbjct: 215 WIYWAGPLIGGGLAGFIYGDVFIG-CHTPLPTSE 247
>TIP1_TOBAC (P21653) Probable aquaporin TIP-type RB7-5A (Tonoplast intrinsic| protein, root-specific RB7-5A) (TobRB7) (RT-TIP) Length = 250 Score = 47.8 bits (112), Expect = 7e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRTHEQLPTTD 259 W+YW GPLIGGGLAG IY +FI H LPT++ Sbjct: 215 WIYWAGPLIGGGLAGFIYGDVFIG-CHTPLPTSE 247
>TIP22_ORYSA (Q5Z6F0) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) (OsTIP2.2) Length = 248 Score = 47.8 bits (112), Expect = 7e-06 Identities = 15/35 (42%), Positives = 27/35 (77%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRTHEQLPTTDY 256 W+YWVGPL+GGGLAG++Y +++ H + ++++ Sbjct: 214 WIYWVGPLVGGGLAGLVYRYVYMCGDHAPVASSEF 248
>TIP32_ARATH (O22588) Probable aquaporin TIP3.2 (Tonoplast intrinsic protein| 3.2) (Beta-tonoplast intrinsic protein) (Beta-TIP) Length = 267 Score = 47.4 bits (111), Expect = 9e-06 Identities = 21/47 (44%), Positives = 25/47 (53%), Gaps = 8/47 (17%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFI--------SRTHEQLPTTDY 256 W W+YWVGP IGG LA +IYE + I TH+ L DY Sbjct: 221 WSNHWIYWVGPFIGGALAALIYEYMIIPSVNEPPHHSTHQPLAPEDY 267
>TIP31_ORYSA (Q9FWV6) Probable aquaporin TIP3.1 (Tonoplast intrinsic protein| 3.1) (OsTIP3.1) Length = 264 Score = 47.0 bits (110), Expect = 1e-05 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 8/47 (17%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFI--------SRTHEQLPTTDY 256 W + WVYW+GP +G GLAG++YE L I H+ L DY Sbjct: 218 WRHHWVYWLGPFVGAGLAGLLYEYLVIPSADAAPHGGAHQPLAPEDY 264
>AQP_AEDAE (Q9NHW7) Aquaporin AQPAe.a| Length = 249 Score = 46.6 bits (109), Expect = 1e-05 Identities = 18/33 (54%), Positives = 23/33 (69%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFISRTHEQ 274 W QWVYWVGP++GG LAG +Y L F R ++ Sbjct: 212 WTDQWVYWVGPIVGGILAGAVYRLFFKVRKGDE 244
>TIP21_ORYSA (Q7XA61) Probable aquaporin TIP2.1 (Tonoplast intrinsic protein| 2.1) (OsTIP2.1) Length = 248 Score = 46.6 bits (109), Expect = 1e-05 Identities = 20/35 (57%), Positives = 27/35 (77%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRTHEQLPTTDY 256 WVYWVGPLIGGGLAG++Y +FI +++ + DY Sbjct: 214 WVYWVGPLIGGGLAGLVYGDVFIG-SYQPVADQDY 247
>TIP_ANTMA (P33560) Probable aquaporin TIP-type (Tonoplast intrinsic protein| DiP) (Dark intrinsic protein) Length = 250 Score = 46.2 bits (108), Expect = 2e-05 Identities = 20/34 (58%), Positives = 25/34 (73%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRTHEQLPTTD 259 W+YW GPLIGG LAG IY +FI+ H LPT++ Sbjct: 215 WIYWAGPLIGGALAGFIYGDVFIT-AHAPLPTSE 247
>TIP22_ARATH (Q41975) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) Length = 250 Score = 45.4 bits (106), Expect = 3e-05 Identities = 19/34 (55%), Positives = 26/34 (76%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRTHEQLPTTD 259 W+YWVGPL+GG LAG+IY +FI ++ PTT+ Sbjct: 215 WIYWVGPLVGGALAGLIYGDVFIG-SYAPAPTTE 247
>TIP32_ORYSA (Q7XKI5) Probable aquaporin TIP3.2 (Tonoplast intrinsic protein| 3.2) (OsTIP3.2) Length = 265 Score = 45.1 bits (105), Expect = 4e-05 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W + WVYW+GPLIG G+AG +YE + Sbjct: 219 WRHHWVYWLGPLIGAGMAGALYEFV 243
>AQP_CICVR (Q23808) Aquaporin AQPcic| Length = 255 Score = 45.1 bits (105), Expect = 4e-05 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFISRTHEQ 274 W WVYW GP++GG +AG+ Y LF +R E+ Sbjct: 216 WANHWVYWAGPIVGGVVAGITYRALFRARKPEE 248
>BIB_DROME (P23645) Neurogenic protein big brain| Length = 696 Score = 44.7 bits (104), Expect = 6e-05 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFISR 286 W WVYW GPL+GG +G++YE +F SR Sbjct: 252 WDSHWVYWFGPLVGGMASGLVYEYIFNSR 280
>TIPA_PHAVU (P23958) Probable aquaporin TIP-type alpha (Tonoplast intrinsic| protein alpha) (Alpha TIP) Length = 256 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 5/44 (11%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFI-----SRTHEQLPTTDY 256 W W++WVGPL+G LA ++YE I H+ L T DY Sbjct: 213 WHQHWIFWVGPLLGAALAALVYEYAVIPIEPPPHHHQPLATEDY 256
>TIP23_ARATH (Q9FGL2) Probable aquaporin TIP2.3 (Tonoplast intrinsic protein| 2.3) Length = 250 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/34 (52%), Positives = 26/34 (76%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRTHEQLPTTD 259 W+YWVGPL+GG LAG+IY +FI ++E + T + Sbjct: 215 WIYWVGPLVGGALAGLIYGDVFIG-SYEAVETRE 247
>AQPA_RANES (P50501) Aquaporin FA-CHIP| Length = 272 Score = 43.1 bits (100), Expect = 2e-04 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = -1 Query: 366 YQWVYWVGPLIGGGLAGVIYELLFISRTHE 277 Y W++WVGP+IGG A +IY+ + RT + Sbjct: 212 YHWIFWVGPMIGGAAAAIIYDFILAPRTSD 241
>AQP4_RAT (P47863) Aquaporin-4 (AQP-4) (WCH4) (Mercurial-insensitive water| channel) (MIWC) Length = 323 Score = 42.7 bits (99), Expect = 2e-04 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLF 295 W W+YWVGP+IG LAG +YE +F Sbjct: 227 WENHWIYWVGPIIGAVLAGALYEYVF 252
>MIP_RAT (P09011) Lens fiber major intrinsic protein (Aquaporin-0) (MIP26)| (MP26) (Fragment) Length = 261 Score = 42.4 bits (98), Expect = 3e-04 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISR 286 WVYWVGP+IGGGL ++Y+ L R Sbjct: 200 WVYWVGPIIGGGLGSLLYDFLLFPR 224
>AQP4_MOUSE (P55088) Aquaporin-4 (AQP-4) (WCH4) (Mercurial-insensitive water| channel) (MIWC) Length = 323 Score = 42.4 bits (98), Expect = 3e-04 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLF 295 W W+YWVGP++G LAG +YE +F Sbjct: 227 WANHWIYWVGPIMGAVLAGALYEYVF 252
>MIP_MOUSE (P51180) Lens fiber major intrinsic protein (Aquaporin-0) (MIP26)| (MP26) Length = 263 Score = 42.4 bits (98), Expect = 3e-04 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISR 286 WVYWVGP+IGGGL ++Y+ L R Sbjct: 202 WVYWVGPIIGGGLGSLLYDFLLFPR 226
>MIP_HUMAN (P30301) Lens fiber major intrinsic protein (Aquaporin-0) (MIP26)| (MP26) Length = 263 Score = 42.4 bits (98), Expect = 3e-04 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISR 286 WVYWVGP+IGGGL ++Y+ L R Sbjct: 202 WVYWVGPIIGGGLGSLLYDFLLFPR 226
>MIP_CAVPO (Q6RZ07) Lens fiber major intrinsic protein (Aquaporin-0)| Length = 263 Score = 42.4 bits (98), Expect = 3e-04 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISR 286 WVYWVGP+IGGGL ++Y+ L R Sbjct: 202 WVYWVGPIIGGGLGSLLYDFLLFPR 226
>MIP_RANPI (Q06019) Lens fiber major intrinsic protein (MIP26) (MP26)| Length = 263 Score = 42.0 bits (97), Expect = 4e-04 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISR 286 WVYWVGP+IGG L G++Y+ + R Sbjct: 202 WVYWVGPIIGGALGGLVYDFILFPR 226
>AQP4_HUMAN (P55087) Aquaporin-4 (AQP-4) (WCH4) (Mercurial-insensitive water| channel) (MIWC) Length = 323 Score = 41.6 bits (96), Expect = 5e-04 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLF 295 W W+YWVGP+IG LAG +YE +F Sbjct: 227 WENHWIYWVGPIIGAVLAGGLYEYVF 252
>AQP4_BOVIN (O77750) Aquaporin-4 (AQP-4) (WCH4) (Mercurial-insensitive water| channel) (MIWC) Length = 323 Score = 41.6 bits (96), Expect = 5e-04 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLF 295 W W+YWVGP+IG LAG +YE +F Sbjct: 227 WENHWIYWVGPIIGAVLAGGLYEYVF 252
>AQP4_DIPME (Q923J4) Aquaporin-4 (AQP-4)| Length = 324 Score = 41.6 bits (96), Expect = 5e-04 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLF 295 W W+YWVGP+IG LAG +YE +F Sbjct: 227 WENHWIYWVGPIIGAVLAGGLYEYVF 252
>TIP31_ARATH (P26587) Aquaporin TIP3.1 (Tonoplast intrinsic protein 3.1)| (Alpha-tonoplast intrinsic protein) (Alpha-TIP) Length = 268 Score = 41.2 bits (95), Expect = 6e-04 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 9/48 (18%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFISR---------THEQLPTTDY 256 W W+YWVGP IG LA +IYE + I H+ L DY Sbjct: 221 WHDHWIYWVGPFIGSALAALIYEYMVIPTEPPTHHAHGVHQPLAPEDY 268
>MIP_SHEEP (Q6J8I9) Lens fiber major intrinsic protein (Aquaporin-0)| Length = 263 Score = 39.7 bits (91), Expect = 0.002 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISR 286 WVYWVGP+IG GL ++Y+ L R Sbjct: 202 WVYWVGPVIGAGLGSLLYDFLLFPR 226
>MIP_BOVIN (P06624) Lens fiber major intrinsic protein (Aquaporin-0) (MIP26)| (MP26) Length = 263 Score = 39.7 bits (91), Expect = 0.002 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISR 286 WVYWVGP+IG GL ++Y+ L R Sbjct: 202 WVYWVGPVIGAGLGSLLYDFLLFPR 226
>AQP1_PIG (Q6PQZ1) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 270 Score = 38.5 bits (88), Expect = 0.004 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRTHE 277 WV+WVGP IGG LA +IY+ + R+ + Sbjct: 211 WVFWVGPFIGGALAVLIYDFILAPRSSD 238
>GLPF_STRCO (P19255) Probable glycerol uptake facilitator protein| Length = 264 Score = 38.1 bits (87), Expect = 0.005 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLF 295 W Y W+ VGPLIGG +AG +Y + F Sbjct: 238 WSYAWIPVVGPLIGGAIAGGVYNVAF 263
>AQP1_CANFA (Q9N2J4) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 270 Score = 38.1 bits (87), Expect = 0.005 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRTHE 277 W++WVGP IGG LA +IY+ + R+ + Sbjct: 211 WIFWVGPFIGGALAVLIYDFILAPRSSD 238
>AQP1_PONPY (Q5R819) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 268 Score = 38.1 bits (87), Expect = 0.005 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRTHE 277 W++WVGP IGG LA +IY+ + R+ + Sbjct: 209 WIFWVGPFIGGALAVLIYDFILAPRSSD 236
>AQP1_MOUSE (Q02013) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) (Early response protein DER2) Length = 268 Score = 38.1 bits (87), Expect = 0.005 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRTHE 277 W++WVGP IGG LA +IY+ + R+ + Sbjct: 209 WIFWVGPFIGGALAVLIYDFILAPRSSD 236
>AQP1_HUMAN (P29972) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) (Urine water channel) Length = 268 Score = 38.1 bits (87), Expect = 0.005 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRTHE 277 W++WVGP IGG LA +IY+ + R+ + Sbjct: 209 WIFWVGPFIGGALAVLIYDFILAPRSSD 236
>AQPZ_RHOPA (P60925) Aquaporin Z| Length = 240 Score = 37.4 bits (85), Expect = 0.009 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -1 Query: 369 GYQWVYWVGPLIGGGLAGVIYELL 298 G W++WV PL+GG L GVIY +L Sbjct: 203 GQLWLFWVAPLLGGVLGGVIYRVL 226
>AQPZ_BRAJA (Q89EG9) Aquaporin Z| Length = 240 Score = 37.0 bits (84), Expect = 0.012 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELL 298 W++WV PLIGG L GVIY L Sbjct: 206 WLFWVAPLIGGALGGVIYRWL 226
>AQP_HAEIE (Q25074) Aquaporin (Water channel 1) (BfWC1)| Length = 251 Score = 37.0 bits (84), Expect = 0.012 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLF 295 W WVYWVGP++G +A ++Y+ +F Sbjct: 212 WIDHWVYWVGPIVGAIVAALLYKFVF 237
>AQY2_YEAST (O93938) Aquaporin-2| Length = 289 Score = 37.0 bits (84), Expect = 0.012 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 366 YQWVYWVGPLIGGGLAGVIYELLFI 292 Y W+YW+GPL+G LA +++LL I Sbjct: 246 YHWIYWIGPLLGAFLAWSVWQLLQI 270
>AQP8_MOUSE (P56404) Aquaporin-8 (AQP-8)| Length = 261 Score = 36.6 bits (83), Expect = 0.015 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W + W+YW+GPL+ G G++ LL Sbjct: 224 WDFHWIYWLGPLLAGLFVGLLIRLL 248
>PIP1_LYCES (Q08451) Probable aquaporin PIP-type pTOM75 (Ripening-associated| membrane protein) (RAMP) Length = 286 Score = 36.6 bits (83), Expect = 0.015 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W W++WVGP+IG LA + ++++ Sbjct: 253 WNDHWIFWVGPMIGAALAAIYHQII 277
>MIP_CHICK (P28238) Lens fiber major intrinsic protein (Aquaporin-0) (AQP0)| (MIP26) (MP26) Length = 262 Score = 36.6 bits (83), Expect = 0.015 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISR 286 WV+W GPL+G LA ++YEL R Sbjct: 202 WVFWAGPLLGAALAALLYELALCPR 226
>AQY1_YEAST (P53386) Aquaporin-1| Length = 327 Score = 36.6 bits (83), Expect = 0.015 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 366 YQWVYWVGPLIGGGLAGVIYELLFI 292 Y W+YW+GPL+G LA +++LL I Sbjct: 247 YHWIYWIGPLLGSILAWSVWQLLQI 271
>PIP25_ORYSA (Q8GRI8) Aquaporin PIP2.5 (Plasma membrane intrinsic protein 2.5)| (OsPIP2.5) Length = 283 Score = 35.8 bits (81), Expect = 0.026 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W QW++WVGP IG +A + ++++ Sbjct: 244 WSDQWIFWVGPFIGAAIAALYHQIV 268
>AQP1_RAT (P29975) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 268 Score = 35.8 bits (81), Expect = 0.026 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRTHE 277 W++WVGP IG LA +IY+ + R+ + Sbjct: 209 WIFWVGPFIGSALAVLIYDFILAPRSSD 236
>AQP8_HUMAN (O94778) Aquaporin-8 (AQP-8)| Length = 261 Score = 35.8 bits (81), Expect = 0.026 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVI 310 W + W+YW+GPL+ G L G++ Sbjct: 224 WNFHWIYWLGPLLAGLLVGLL 244
>AQP1_SHEEP (P56401) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 271 Score = 35.8 bits (81), Expect = 0.026 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRTHE 277 W++WVGP IG LA +IY+ + R+ + Sbjct: 212 WIFWVGPFIGAALAVLIYDFILAPRSSD 239
>AQP1_BOVIN (P47865) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) (Water channel protein CHIP29) Length = 270 Score = 35.8 bits (81), Expect = 0.026 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRTHE 277 W++WVGP IG LA +IY+ + R+ + Sbjct: 211 WIFWVGPFIGAALAVLIYDFILAPRSSD 238
>PIP24_ORYSA (Q8GRT8) Aquaporin PIP2.4 (Plasma membrane intrinsic protein 2.4)| (OsPIP2.4) Length = 286 Score = 35.8 bits (81), Expect = 0.026 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W QW++WVGP IG +A + ++++ Sbjct: 247 WSDQWIFWVGPFIGAAIAALYHQVI 271
>PIP22_ORYSA (Q6K215) Probable aquaporin PIP2.2 (Plasma membrane intrinsic| protein 2.2) (OsPIP2.2) Length = 288 Score = 35.4 bits (80), Expect = 0.034 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYE 304 W QW++WVGPLIG +A ++ Sbjct: 249 WDDQWIFWVGPLIGAAIAAAYHQ 271
>PIP11_ORYSA (Q6EU94) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (OsPIP1.1) (Water channel protein RWC1) (RWC-1) Length = 289 Score = 35.0 bits (79), Expect = 0.044 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W W++WVGP +G LA + ++++ Sbjct: 255 WNDHWIFWVGPFVGAALAAIYHQVI 279
>PIP13_ARATH (Q08733) Aquaporin PIP1.3 (Plasma membrane intrinsic protein 1c)| (PIP1c) (Transmembrane protein B) (TMP-B) Length = 286 Score = 35.0 bits (79), Expect = 0.044 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W W++WVGP IG LA + ++L+ Sbjct: 252 WDDHWIFWVGPFIGAALAALYHQLV 276
>AQP8_RAT (P56405) Aquaporin-8 (AQP-8)| Length = 263 Score = 35.0 bits (79), Expect = 0.044 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYEL 301 W + W+YW+GPL+ G G++ L Sbjct: 226 WDFHWIYWLGPLLAGLFVGLLIRL 249
>PIP12_ORYSA (Q7XSQ9) Probable aquaporin PIP1.2 (Plasma membrane intrinsic| protein 1.2) (OsPIP1.2) Length = 282 Score = 34.7 bits (78), Expect = 0.058 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W W++WVGP IG LA + ++++ Sbjct: 248 WDDHWIFWVGPFIGAALAAIYHQVV 272
>GLPF_BACSU (P18156) Glycerol uptake facilitator protein| Length = 274 Score = 34.7 bits (78), Expect = 0.058 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLF 295 W Y WV VGP++GG GV Y F Sbjct: 209 WKYAWVPVVGPILGGSFGGVFYNAAF 234
>PIP2_PEA (P25794) Probable aquaporin PIP-type 7a (Turgor-responsive protein| 7a) (Turgor-responsive protein 31) Length = 289 Score = 34.3 bits (77), Expect = 0.076 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W W++WVGP IG LA + ++++ Sbjct: 256 WNDHWIFWVGPFIGAALAALYHQVV 280
>PIP15_ARATH (Q8LAA6) Probable aquaporin PIP1.5 (Plasma membrane intrinsic| protein 1d) (PIP1d) Length = 287 Score = 34.3 bits (77), Expect = 0.076 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W W++WVGP IG LA + ++++ Sbjct: 253 WDDHWIFWVGPFIGAALAALYHQIV 277
>PIP14_ARATH (Q39196) Probable aquaporin PIP1.4 (Plasma membrane intrinsic| protein 1.4) (Transmembrane protein C) (TMP-C) Length = 287 Score = 34.3 bits (77), Expect = 0.076 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W W++WVGP IG LA + ++++ Sbjct: 253 WDDHWIFWVGPFIGAALAALYHQIV 277
>AQPZ_PHOLL (Q7N5C1) Aquaporin Z| Length = 231 Score = 33.9 bits (76), Expect = 0.099 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISR 286 W +WV P+IGG + G IY LLF + Sbjct: 206 WFFWVMPIIGGIVGGGIYRLLFAEK 230
>PIP24_ARATH (Q9FF53) Probable aquaporin PIP2.4 (Plasma membrane intrinsic| protein 2.4) Length = 291 Score = 33.9 bits (76), Expect = 0.099 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W QW++WVGP+IG A ++ + Sbjct: 245 WDDQWIFWVGPMIGAAAAAFYHQFI 269
>AQP6_HUMAN (Q13520) Aquaporin-6 (AQP-6) (Aquaporin-2-like) (hKID)| Length = 282 Score = 33.9 bits (76), Expect = 0.099 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRT 283 WV+WVGPL+G LA +IY + T Sbjct: 214 WVFWVGPLMGALLASLIYNFVLFPDT 239
>GLPF_THEMA (Q9X1E3) Probable glycerol uptake facilitator protein| Length = 234 Score = 33.9 bits (76), Expect = 0.099 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLF 295 W Y WV +GP+IGG L +Y LF Sbjct: 209 WSYSWVPIIGPIIGGILGASLYNWLF 234
>TIP51_ARATH (Q9STX9) Putative aquaporin TIP5.1 (Tonoplast intrinsic protein| 5.1) Length = 256 Score = 33.5 bits (75), Expect = 0.13 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -1 Query: 363 QWVYWVGPLIGGGLAGVIYE 304 Q VYWVGPL+GG A ++Y+ Sbjct: 217 QAVYWVGPLLGGATAALVYD 236
>AQP6_MOUSE (Q8C4A0) Aquaporin-6 (AQP-6)| Length = 293 Score = 33.5 bits (75), Expect = 0.13 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRT 283 W++WVGPL G LA +IY + T Sbjct: 211 WIFWVGPLTGAVLASLIYNFILFPDT 236
>AQP6_RAT (Q9WTY0) Aquaporin-6 (AQP-6)| Length = 276 Score = 33.5 bits (75), Expect = 0.13 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRT 283 W++WVGPL G LA +IY + T Sbjct: 211 WIFWVGPLTGAVLASLIYNFILFPDT 236
>AQP5_RAT (P47864) Aquaporin-5 (AQP-5)| Length = 265 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIY-ELLFIS 289 WV+WVGP++G LA ++Y LLF S Sbjct: 204 WVFWVGPIVGAMLAAILYFYLLFPS 228
>AQP5_MOUSE (Q9WTY4) Aquaporin-5 (AQP-5)| Length = 265 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIY-ELLFIS 289 WV+WVGP++G LA ++Y LLF S Sbjct: 204 WVFWVGPIVGAVLAAILYFYLLFPS 228
>PIP26_ARATH (Q9ZV07) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2e) (PIP2e) Length = 289 Score = 33.5 bits (75), Expect = 0.13 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W QW++WVGP +G +A ++ + Sbjct: 244 WDDQWIFWVGPFVGAAIAAFYHQFV 268
>PIP27_ORYSA (Q651D5) Probable aquaporin PIP2.7 (Plasma membrane intrinsic| protein 2.7) (OsPIP2.7) Length = 290 Score = 33.1 bits (74), Expect = 0.17 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W W++WVGP+IG LA ++L+ Sbjct: 247 WKDHWIFWVGPVIGAFLAAAYHKLV 271
>PIP23_ORYSA (Q7XUA6) Probable aquaporin PIP2.3 (Plasma membrane intrinsic| protein 2.3) (OsPIP2.3) Length = 290 Score = 33.1 bits (74), Expect = 0.17 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYE 304 W W++WVGPLIG +A ++ Sbjct: 250 WHDHWIFWVGPLIGAAIAAAYHQ 272
>AQP5_SHEEP (Q866S3) Aquaporin-5 (AQP-5)| Length = 265 Score = 33.1 bits (74), Expect = 0.17 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIY 307 WV+WVGP++G A +IY Sbjct: 204 WVFWVGPIVGAATAAIIY 221
>AQP5_HUMAN (P55064) Aquaporin-5 (AQP-5)| Length = 265 Score = 33.1 bits (74), Expect = 0.17 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIY 307 WV+WVGP++G LA ++Y Sbjct: 204 WVFWVGPIVGAVLAAILY 221
>PIP12_ARATH (Q06611) Aquaporin PIP1.2 (Plasma membrane intrinsic protein 1b)| (PIP1b) (Transmembrane protein A) (TMP-A) (AthH2) Length = 286 Score = 33.1 bits (74), Expect = 0.17 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W WV+WVGP IG LA + + ++ Sbjct: 252 WDDHWVFWVGPFIGAALAALYHVIV 276
>AQP2_MOUSE (P56402) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 32.7 bits (73), Expect = 0.22 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRT 283 WV+W+GPL+G + ++Y L T Sbjct: 202 WVFWIGPLVGAVIGSLLYNYLLFPST 227
>PIP13_ORYSA (Q9SXF8) Aquaporin PIP 1.3 (Plasma membrane intrinsic protein 1.3)| (OsPIP1.3) (Water channel protein RWC3) (RWC-3) Length = 288 Score = 32.7 bits (73), Expect = 0.22 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIY 307 W W++WVGP IG LA + + Sbjct: 254 WHDHWIFWVGPFIGAALAAIYH 275
>PIP11_VICFA (P61838) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 32.7 bits (73), Expect = 0.22 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIY 307 W WV+WVGP IG LA + + Sbjct: 252 WDDHWVFWVGPFIGAALAALYH 273
>PIP11_ARATH (P61837) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 32.7 bits (73), Expect = 0.22 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIY 307 W WV+WVGP IG LA + + Sbjct: 252 WDDHWVFWVGPFIGAALAALYH 273
>AQPZ_VIBPA (Q87MQ5) Aquaporin Z| Length = 232 Score = 32.3 bits (72), Expect = 0.29 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELL 298 W++WV P++GG L VIY+ L Sbjct: 205 WLFWVAPIVGGVLGAVIYKNL 225
>AQP9_RAT (P56627) Aquaporin-9 (AQP-9)| Length = 295 Score = 32.3 bits (72), Expect = 0.29 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 9/43 (20%) Frame = -1 Query: 372 WGYQ---------WVYWVGPLIGGGLAGVIYELLFISRTHEQL 271 WG++ W+ VGP+IG L G+IY +LFI H +L Sbjct: 232 WGFEVFTVGNNFWWIPVVGPMIGAFLGGLIY-ILFIQMHHSKL 273
>AQPZ1_RHIME (Q92NM3) Aquaporin Z 1| Length = 228 Score = 32.3 bits (72), Expect = 0.29 Identities = 9/21 (42%), Positives = 18/21 (85%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELL 298 W++WV PLIG +AG++++++ Sbjct: 204 WLFWVAPLIGAVIAGIVWKIV 224
>PIP22_ARATH (P43287) Aquaporin PIP2.2 (Plasma membrane intrinsic protein 2b)| (PIP2b) (TMP2b) Length = 285 Score = 32.0 bits (71), Expect = 0.38 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W W++WVGP IG +A ++ + Sbjct: 243 WDDHWIFWVGPFIGAAIAAFYHQFV 267
>PIP25_ARATH (Q9SV31) Probable aquaporin PIP2.5 (Plasma membrane intrinsic| protein 2d) (PIP2d) Length = 286 Score = 32.0 bits (71), Expect = 0.38 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W + W++WVGP G +A ++ + Sbjct: 244 WDHHWIFWVGPFAGAAIAAFYHQFV 268
>PIP21_ARATH (P43286) Aquaporin PIP2.1 (Plasma membrane intrinsic protein 2a)| (PIP2a) Length = 287 Score = 32.0 bits (71), Expect = 0.38 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W W++WVGP IG +A ++ + Sbjct: 245 WDDHWIFWVGPFIGAAIAAFYHQFV 269
>AQPZ_PSEPK (Q88F17) Aquaporin Z| Length = 230 Score = 31.6 bits (70), Expect = 0.49 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -1 Query: 372 WGYQ--WVYWVGPLIGGGLAGVIY 307 W Q W++WV PLIG + G +Y Sbjct: 200 WALQQLWLFWVAPLIGAAIGGALY 223
>AQPZ_SHIFL (O68874) Aquaporin Z| Length = 231 Score = 31.6 bits (70), Expect = 0.49 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISR 286 W +WV P++GG + G+IY L R Sbjct: 206 WFFWVVPIVGGIIGGLIYRTLLEKR 230
>AQPZ_ECOLI (P60844) Aquaporin Z (Bacterial nodulin-like intrinsic protein)| Length = 231 Score = 31.6 bits (70), Expect = 0.49 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISR 286 W +WV P++GG + G+IY L R Sbjct: 206 WFFWVVPIVGGIIGGLIYRTLLEKR 230
>AQPZ_ECOL6 (P60845) Aquaporin Z| Length = 231 Score = 31.6 bits (70), Expect = 0.49 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISR 286 W +WV P++GG + G+IY L R Sbjct: 206 WFFWVVPIVGGIIGGLIYRTLLEKR 230
>AQPZ_ECO57 (Q8X6K6) Aquaporin Z| Length = 231 Score = 31.6 bits (70), Expect = 0.49 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISR 286 W +WV P++GG + G+IY L R Sbjct: 206 WFFWVVPIVGGIIGGLIYRTLLEKR 230
>PIP21_ORYSA (Q8H5N9) Probable aquaporin PIP2.1 (Plasma membrane intrinsic| protein 2a) (PIP2a) (OsPIP2.1) Length = 290 Score = 31.6 bits (70), Expect = 0.49 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W W++WVGP +G +A ++ + Sbjct: 250 WHNHWIFWVGPFVGAAIAAFYHQYI 274
>AQPZ_SHEON (Q8EHC1) Aquaporin Z| Length = 229 Score = 31.6 bits (70), Expect = 0.49 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIY 307 W++W P+IG LAGVIY Sbjct: 205 WLFWAAPIIGAILAGVIY 222
>S26A1_MOUSE (P58735) Sulfate anion transporter 1 (SAT-1) (Solute carrier family| 26 member 1) Length = 704 Score = 31.2 bits (69), Expect = 0.64 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 45 GRIHRFYTSKLTGSIVTGFTAPQTDGP 125 G++H + S++ G+I TGF APQ P Sbjct: 314 GQLHTRFDSRVAGNIPTGFVAPQVPDP 340
>AQP2_SHEEP (O62735) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 31.2 bits (69), Expect = 0.64 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIY 307 WV+W+GPL+G +A ++Y Sbjct: 202 WVFWIGPLVGAIVASLLY 219
>AQP2_RAT (P34080) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 31.2 bits (69), Expect = 0.64 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELL 298 WV+W+GPL+G + ++Y L Sbjct: 202 WVFWIGPLVGAIIGSLLYNYL 222
>TIP51_ORYSA (Q7XU31) Probable aquaporin TIP5.1 (Tonoplast intrinsic protein| 5.1) (OsTIP5.1) Length = 269 Score = 31.2 bits (69), Expect = 0.64 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -1 Query: 363 QWVYWVGPLIGGGLAGVIYELLFISRTHEQLP 268 Q VYW GP++G +A ++++ L E P Sbjct: 220 QAVYWAGPMVGAAVAALVHQALVFPTVPEPAP 251
>PIP23_ARATH (P30302) Aquaporin PIP2.3 (Plasma membrane intrinsic protein 2c)| (PIP2c) (TMP2C) (RD28-PIP) (Water stress-induced tonoplast intrinsic protein) (WSI-TIP) Length = 285 Score = 31.2 bits (69), Expect = 0.64 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W W++WVGP IG +A ++ + Sbjct: 243 WDDHWIFWVGPFIGATIAAFYHQFV 267
>GLPF_STRR6 (P0A3Q8) Glycerol uptake facilitator protein| Length = 234 Score = 31.2 bits (69), Expect = 0.64 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYEL 301 W Y W+ VGP+IG LA +++ L Sbjct: 210 WSYAWIPVVGPVIGAALAVLVFSL 233
>GLPF_STRPN (P0A3Q7) Glycerol uptake facilitator protein| Length = 234 Score = 31.2 bits (69), Expect = 0.64 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYEL 301 W Y W+ VGP+IG LA +++ L Sbjct: 210 WSYAWIPVVGPVIGAALAVLVFSL 233
>PIP28_ORYSA (Q7Y1E6) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 2.8) (OsPIP2.8) Length = 280 Score = 30.8 bits (68), Expect = 0.84 Identities = 9/39 (23%), Positives = 18/39 (46%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFISRTHEQLPTTDY 256 W + W++WVGP G A + + + + ++ Y Sbjct: 237 WSHLWIFWVGPFAGAAAAMIYHHYILRGAAAKAFASSSY 275
>PIP27_ARATH (P93004) Aquaporin PIP2.7 (Plasma membrane intrinsic protein 3)| (Salt stress-induced major intrinsic protein) Length = 280 Score = 30.8 bits (68), Expect = 0.84 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W QW++WVGP +G A ++ + Sbjct: 238 WDDQWIFWVGPFLGALAAAAYHQYI 262
>AQP2_HUMAN (P41181) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 30.8 bits (68), Expect = 0.84 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIY 307 WV+W+GPL+G L ++Y Sbjct: 202 WVFWIGPLVGAILGSLLY 219
>AQPZ2_RHIME (Q92ZW9) Aquaporin Z 2| Length = 232 Score = 30.4 bits (67), Expect = 1.1 Identities = 7/19 (36%), Positives = 15/19 (78%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYE 304 W++W+ PL G +AG++++ Sbjct: 204 WLFWIAPLFGAAIAGIVWK 222
>AQPZ_GLOVI (Q7NNP3) Aquaporin Z| Length = 248 Score = 30.4 bits (67), Expect = 1.1 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIY 307 W++W+ P++G LAG+ Y Sbjct: 207 WLFWLAPIVGAALAGLFY 224
>AQPZ2_AGRT5 (Q8UJW4) Aquaporin Z 2| Length = 228 Score = 30.4 bits (67), Expect = 1.1 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -1 Query: 372 WGYQ--WVYWVGPLIGGGLAGVIYEL 301 W Q W++W+ P++GG VI++L Sbjct: 198 WALQQLWLFWLAPIVGGAAGAVIWKL 223
>AQP9_MOUSE (Q9JJJ3) Aquaporin-9 (AQP-9)| Length = 295 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 9/40 (22%) Frame = -1 Query: 372 WGYQ---------WVYWVGPLIGGGLAGVIYELLFISRTH 280 WG++ W+ VGP+IG L G+IY +LFI H Sbjct: 232 WGFEVFTFGNNFWWIPVVGPMIGAVLGGLIY-VLFIQMHH 270
>AQPZ1_AGRT5 (Q8UI24) Aquaporin Z 1| Length = 241 Score = 30.0 bits (66), Expect = 1.4 Identities = 8/26 (30%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = -1 Query: 372 WGYQ--WVYWVGPLIGGGLAGVIYEL 301 W Q W++W+ P++GG + V++++ Sbjct: 198 WALQQLWLFWLAPILGGAIGAVVWKI 223
>AQPM_METTM (Q9C4Z5) Aquaporin aqpM| Length = 246 Score = 29.6 bits (65), Expect = 1.9 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W Y +Y +GP++G LA + Y+ L Sbjct: 219 WNYYSIYVIGPIVGAVLAALTYQYL 243
>PTV3B_ERWCH (P26207) PTS system beta-glucoside-specific EIIBCA component| (EIIBCA-Bgl) (EII-Bgl) [Includes: Beta-glucoside-specific phosphotransferase enzyme IIB component (EC 2.7.1.69) (PTS system beta-glucoside-specific EIIB component); Beta-glucoside p Length = 631 Score = 29.6 bits (65), Expect = 1.9 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -1 Query: 369 GYQWVYWVGPLIGGGLAGVIYELLFISRTH 280 GYQW+Y + L+ G + G ++++ I H Sbjct: 280 GYQWLYGLNSLLAGAVMGALWQVCVIFGLH 309
>POLG_TMEVG (P08545) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2303 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 Query: 236 PPPARPSVWSIASPLASSHESFKFALN 156 PPPA P+V PL ++E F FA N Sbjct: 1180 PPPACPNVMQPQGPLREANEGFTFAKN 1206
>POLG_TMEVB (P08544) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2303 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 Query: 236 PPPARPSVWSIASPLASSHESFKFALN 156 PPPA P+V PL ++E F FA N Sbjct: 1180 PPPACPNVMQPQGPLREANEGFTFAKN 1206
>S26A1_RAT (P45380) Sulfate anion transporter 1 (SAT-1) (Solute carrier family| 26 member 1) (Canalicular sulfate transporter) (Sulfate/carbonate antiporter) Length = 703 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 45 GRIHRFYTSKLTGSIVTGFTAPQTDGP 125 G++H + S + G+I TGF APQ P Sbjct: 313 GQLHTRFGSSVAGNIPTGFVAPQIPDP 339
>AQPZ_VIBVY (Q7MIV9) Aquaporin Z| Length = 231 Score = 29.3 bits (64), Expect = 2.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELL 298 W++WV P++G L V Y+L+ Sbjct: 205 WLFWVAPILGALLGAVAYKLI 225
>AQPZ_VIBVU (Q8DB17) Aquaporin Z| Length = 231 Score = 29.3 bits (64), Expect = 2.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELL 298 W++WV P++G L V Y+L+ Sbjct: 205 WLFWVAPILGALLGAVAYKLI 225
>RECK_MOUSE (Q9Z0J1) Reversion-inducing cysteine-rich protein with Kazal motifs| precursor (mRECK) Length = 971 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/55 (25%), Positives = 24/55 (43%) Frame = -2 Query: 230 PARPSVWSIASPLASSHESFKFALNE*IHPIPRVDRSISLWCCETCDDRPCQFAC 66 P + ++ + AS +N P + + SL+CC+ +D CQ AC Sbjct: 175 PGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNAC 229
>RECK_HUMAN (O95980) Reversion-inducing cysteine-rich protein with Kazal motifs| precursor (hRECK) (Suppressor of tumorigenicity 15) (ST15) Length = 971 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/55 (25%), Positives = 24/55 (43%) Frame = -2 Query: 230 PARPSVWSIASPLASSHESFKFALNE*IHPIPRVDRSISLWCCETCDDRPCQFAC 66 P + ++ + AS +N P + + SL+CC+ +D CQ AC Sbjct: 175 PGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNAC 229
>PIP28_ARATH (Q9ZVX8) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 3b) (PIP3b) Length = 278 Score = 29.3 bits (64), Expect = 2.4 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W W++WVGP +G A ++ + Sbjct: 236 WDDHWIFWVGPFVGALAAAAYHQYI 260
>AQPZ_SYNY3 (P73809) Aquaporin Z| Length = 247 Score = 28.9 bits (63), Expect = 3.2 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 369 GYQWVYWVGPLIGGGLAGVIY 307 G W++W+ P+ G LAG +Y Sbjct: 212 GQLWLFWLAPIAGALLAGFVY 232
>PIP1_ATRCA (P42767) Aquaporin PIP-type| Length = 282 Score = 28.9 bits (63), Expect = 3.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIY 307 W W++WVGP + G LA Y Sbjct: 240 WDDHWIFWVGPFV-GALAAAAY 260
>AQPZ_CHRVO (Q7NU39) Aquaporin Z| Length = 229 Score = 28.9 bits (63), Expect = 3.2 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -1 Query: 372 WGYQ--WVYWVGPLIGGGLAGVIYELL 298 W Q W++W+ P+IG L +Y L+ Sbjct: 198 WAVQQLWLFWLAPIIGAVLGAKVYRLI 224
>PAFA2_HUMAN (Q99487) Platelet-activating factor acetylhydrolase 2, cytoplasmic| (EC 3.1.1.47) (Serine-dependent phospholipase A2) (HSD-PLA2) Length = 392 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/44 (29%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = +3 Query: 45 GRIHRFYT--SKLTGSIVTGFTAPQTDGPIDPGNGMDSFIQSKL 170 G +HR T + +TG+++ F + +T G +DP G + +++ L Sbjct: 311 GSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAML 354
>DAB2_RAT (O88797) Disabled homolog 2 (DOC-2) (Mitogen-responsive| phosphoprotein) (C9) Length = 768 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 260 SVVGSCSWVREMKSSS*MTPARPPPMRGPTQYT 358 S + + S+ + M SS +TP +PPP GP + T Sbjct: 600 STISTQSFPQPMMSSVLVTPPQPPPRNGPLKDT 632
>SYE_SULTO (Q971D0) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 566 Score = 28.5 bits (62), Expect = 4.2 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +3 Query: 72 KLTGSIVTGFTAPQTDGPIDPGNGMDSFIQSKLKRLMTG 188 K+ G VT F AP DGPI GN + I K + G Sbjct: 94 KVEGKFVTRF-APNPDGPIHLGNARAAIISYKYAEMYKG 131
>YFF4_YEAST (P43549) Hypothetical 70.5 kDa protein in AGP3-DAK3 intergenic| region Length = 646 Score = 28.5 bits (62), Expect = 4.2 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELLFIS 289 W + W W GP+ GG +IY++ + Sbjct: 564 WWWTWGAWGGPIAGGIAGALIYDIFIFT 591
>S26A1_HUMAN (Q9H2B4) Sulfate anion transporter 1 (SAT-1) (Solute carrier family| 26 member 1) Length = 701 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 45 GRIHRFYTSKLTGSIVTGFTAPQTDGP 125 G++H+ + S + G I TGF PQ P Sbjct: 309 GQLHKRFGSSVAGDIPTGFMPPQVPEP 335
>AQPM_METTH (O26206) Aquaporin aqpM| Length = 246 Score = 28.1 bits (61), Expect = 5.4 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W Y +Y +GP++G LA + Y+ L Sbjct: 219 WNYFPIYVIGPVVGAVLAALTYQYL 243
>PIP26_ORYSA (Q7XLR1) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2.6) (OsPIP2.6) Length = 282 Score = 28.1 bits (61), Expect = 5.4 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -1 Query: 372 WGYQWVYWVGPLIGGGLAGVIYELL 298 W W++W GP IG A ++ + Sbjct: 240 WDDHWIFWAGPFIGALAAAAYHQYI 264
>CYB5M_PONPY (Q5RDJ5) Cytochrome b5 outer mitochondrial membrane isoform| precursor Length = 146 Score = 28.1 bits (61), Expect = 5.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIY 307 W YW+ P+IG L G +Y Sbjct: 119 WAYWILPIIGAVLLGFLY 136
>CYB5M_HUMAN (O43169) Cytochrome b5 outer mitochondrial membrane isoform| precursor Length = 146 Score = 28.1 bits (61), Expect = 5.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIY 307 W YW+ P+IG L G +Y Sbjct: 119 WAYWILPIIGAVLLGFLY 136
>AQPZ_PSEAE (Q9HWZ3) Aquaporin Z| Length = 229 Score = 28.1 bits (61), Expect = 5.4 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELL 298 W++WV P++G L + Y L+ Sbjct: 204 WLFWVAPILGAVLGALAYRLI 224
>AQP7_HUMAN (O14520) Aquaporin-7 (AQP-7) (Aquaporin-7-like) (Aquaporin adipose)| (AQPap) Length = 342 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYELLFISRTHEQLP 268 WV V PL+G L G+IY L+FI T + P Sbjct: 255 WVPVVAPLLGAYLGGIIY-LVFIGSTIPREP 284
>VG75_EHV1V (P84446) Hypothetical gene 75 protein| Length = 130 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 Query: 351 WVGPLIGGGLAGVIYELLF 295 WV P+IG LA +YELLF Sbjct: 111 WVAPMIGHFLAMCMYELLF 129
>VG75_EHV1B (P28985) Hypothetical gene 75 protein| Length = 130 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 Query: 351 WVGPLIGGGLAGVIYELLF 295 WV P+IG LA +YELLF Sbjct: 111 WVAPMIGHFLAMCMYELLF 129
>SYE_SULAC (Q4J8P2) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 567 Score = 27.7 bits (60), Expect = 7.1 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 75 LTGSIVTGFTAPQTDGPIDPGNGMDSFIQSKLKRLMTG 188 ++G +VT F AP DGP+ GN + I + R+ G Sbjct: 96 VSGVLVTRF-APNPDGPLHLGNARAAIISHEYARIYNG 132
>HMP_ERWCT (Q6D245) Flavohemoprotein (Hemoglobin-like protein)| (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17) (NO oxygenase) (NOD) Length = 396 Score = 27.7 bits (60), Expect = 7.1 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +3 Query: 27 T*NYSGGRIHRFYTSKLTGSIVTGFTAPQTDG-PI---DPGNGMDSFIQ 161 T +SG R R +L S++T FT TDG PI PG + +I+ Sbjct: 146 TGGWSGVRPFRIVNKQLQSSVITSFTLEPTDGQPIADFQPGQYLAIYIK 194
>AQP9_HUMAN (O43315) Aquaporin-9 (AQP-9) (Small solute channel 1)| Length = 295 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 9/34 (26%) Frame = -1 Query: 372 WGYQ---------WVYWVGPLIGGGLAGVIYELL 298 WG++ W+ VGPL+G + G+IY L+ Sbjct: 232 WGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLV 265
>POLG_TMEVD (P13899) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2301 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 236 PPPARPSVWSIASPLASSHESFKFALN 156 PPP P+V PL ++E F FA N Sbjct: 1178 PPPVCPNVLQPQGPLREANEGFTFAKN 1204
>CYB5M_RAT (P04166) Cytochrome b5 outer mitochondrial membrane isoform| precursor Length = 146 Score = 27.7 bits (60), Expect = 7.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIY 307 W YW+ P++G L G +Y Sbjct: 119 WAYWIVPIVGAILIGFLY 136
>SI1L2_RAT (Q5JCS6) Signal-induced proliferation-associated 1-like protein 2| (Serine-rich synapse-associated protein) Length = 1722 Score = 27.3 bits (59), Expect = 9.3 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -2 Query: 188 SSHESFKFA--LNE*IHPIPRVDRSISLWCCETC 93 S HE+FKF L E R+DR I W C+ C Sbjct: 301 SEHETFKFTSDLEE-----GRLDRGIRPWSCQRC 329
>SI1L2_MOUSE (Q80TE4) Signal-induced proliferation-associated 1-like protein 2| Length = 1722 Score = 27.3 bits (59), Expect = 9.3 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -2 Query: 188 SSHESFKFA--LNE*IHPIPRVDRSISLWCCETC 93 S HE+FKF L E R+DR I W C+ C Sbjct: 301 SEHETFKFTSDLEE-----GRLDRGIRPWSCQRC 329
>AQPZ_BRUSU (Q8FY85) Aquaporin Z| Length = 228 Score = 27.3 bits (59), Expect = 9.3 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYE 304 W++WV PL+G + +I++ Sbjct: 204 WLFWVAPLVGAVIGAIIWK 222
>AQPZ_BRUME (Q9L772) Aquaporin Z| Length = 228 Score = 27.3 bits (59), Expect = 9.3 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYE 304 W++WV PL+G + +I++ Sbjct: 204 WLFWVAPLVGAVIGAIIWK 222
>AQPZ_BRUAB (P0C112) Aquaporin Z (Aquaporin X)| Length = 228 Score = 27.3 bits (59), Expect = 9.3 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYE 304 W++WV PL+G + +I++ Sbjct: 204 WLFWVAPLVGAVIGAIIWK 222
>AQPZ_BRUA2 (Q2YR68) Aquaporin Z (Aquaporin X)| Length = 228 Score = 27.3 bits (59), Expect = 9.3 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = -1 Query: 360 WVYWVGPLIGGGLAGVIYE 304 W++WV PL+G + +I++ Sbjct: 204 WLFWVAPLVGAVIGAIIWK 222
>IGHD_HUMAN (P01880) Ig delta chain C region| Length = 383 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +2 Query: 281 WVREMK--SSS*MTPARPPPMRGPTQYTHW 364 W+ + + ++S PARPPP G T + W Sbjct: 308 WLEDQREVNTSGFAPARPPPQPGSTTFWAW 337 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,834,895 Number of Sequences: 219361 Number of extensions: 812179 Number of successful extensions: 2797 Number of sequences better than 10.0: 155 Number of HSP's better than 10.0 without gapping: 2723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2795 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)