| Clone Name | rbart58g09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EXP17_ARATH (Q9ZSI1) Putative alpha-expansin 17 precursor (AtEXP... | 32 | 0.42 | 2 | EXP11_ARATH (Q9LNU3) Alpha-expansin 11 precursor (AtEXPA11) (At-... | 32 | 0.55 | 3 | Q300_MOUSE (Q02722) Protein Q300 | 29 | 2.7 | 4 | CYT4_NEUCR (P47950) Mitochondrial protein cyt-4 | 28 | 7.9 | 5 | VP2_AHSV6 (O71024) Outer capsid protein VP2 | 28 | 7.9 |
|---|
>EXP17_ARATH (Q9ZSI1) Putative alpha-expansin 17 precursor (AtEXPA17) (At-EXP17)| (AtEx17) (Ath-ExpAlpha-1.13) Length = 255 Score = 32.0 bits (71), Expect = 0.42 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 282 VVPRTWRFGQTFSSNLQF 229 VVP WRFGQ+F SN+ F Sbjct: 238 VVPSNWRFGQSFKSNVNF 255
>EXP11_ARATH (Q9LNU3) Alpha-expansin 11 precursor (AtEXPA11) (At-EXP11) (AtEx11)| (Ath-ExpAlpha-1.14) Length = 252 Score = 31.6 bits (70), Expect = 0.55 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -2 Query: 282 VVPRTWRFGQTFSSNLQF 229 VVP +W FGQ +SSN+QF Sbjct: 235 VVPSSWSFGQIYSSNVQF 252
>Q300_MOUSE (Q02722) Protein Q300| Length = 77 Score = 29.3 bits (64), Expect = 2.7 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 101 IYFSCIGLCACLKVQSTCTLACMC 30 +++ C+ +C C+ V CTL CMC Sbjct: 24 LFYVCVCVCVCVCV-CVCTLTCMC 46
>CYT4_NEUCR (P47950) Mitochondrial protein cyt-4| Length = 1117 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -2 Query: 273 RTWRFGQTFSSNLQFK*SRSVDDVRRTCVKMNLD 172 R WRFG+ + K + +V +V+ TCV+ +D Sbjct: 995 RAWRFGEGKEGQVPEKFTYTVVNVQNTCVRGRID 1028
>VP2_AHSV6 (O71024) Outer capsid protein VP2| Length = 1051 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 120 WMCWVVDLLFLYRIVCLLKSSKY 52 W+ WVVDL+ L ++ L+K K+ Sbjct: 428 WVDWVVDLIMLAQVKMLIKEYKF 450 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,165,475 Number of Sequences: 219361 Number of extensions: 745595 Number of successful extensions: 1718 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1718 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)