| Clone Name | rbart57h04 |
|---|---|
| Clone Library Name | barley_pub |
>GALM_MOUSE (Q8K157) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| Length = 342 Score = 60.8 bits (146), Expect = 8e-10 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -3 Query: 263 KGKPGKVYGQYGALSLETQAYPDAVNHPNFPSSIVRPGQVYKHDMVFRFS 114 KGK G VY ++ L LETQ +PD+VN P FP +++RPG+ Y H F+FS Sbjct: 291 KGKNGAVYPKHSGLCLETQNWPDSVNQPQFPPALLRPGEEYNHTTWFKFS 340
>GALM_RAT (Q66HG4) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| Length = 342 Score = 60.5 bits (145), Expect = 1e-09 Identities = 26/50 (52%), Positives = 34/50 (68%) Frame = -3 Query: 263 KGKPGKVYGQYGALSLETQAYPDAVNHPNFPSSIVRPGQVYKHDMVFRFS 114 KGK G+VY ++ LETQ +PDAVN P FP ++RPG+ Y H F+FS Sbjct: 291 KGKSGEVYPKHSGFCLETQNWPDAVNQPQFPPILLRPGEEYNHTTWFKFS 340
>GALM_PONPY (Q5R8U1) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| Length = 342 Score = 58.9 bits (141), Expect = 3e-09 Identities = 26/50 (52%), Positives = 33/50 (66%) Frame = -3 Query: 263 KGKPGKVYGQYGALSLETQAYPDAVNHPNFPSSIVRPGQVYKHDMVFRFS 114 KGK G VY ++ LETQ +PDAVN P FP ++RPG+ Y H F+FS Sbjct: 291 KGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFS 340
>GALM_HUMAN (Q96C23) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| (BLOCK25 protein) Length = 342 Score = 58.9 bits (141), Expect = 3e-09 Identities = 26/50 (52%), Positives = 33/50 (66%) Frame = -3 Query: 263 KGKPGKVYGQYGALSLETQAYPDAVNHPNFPSSIVRPGQVYKHDMVFRFS 114 KGK G VY ++ LETQ +PDAVN P FP ++RPG+ Y H F+FS Sbjct: 291 KGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFS 340
>GALM_BOVIN (Q5EA79) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| Length = 342 Score = 57.0 bits (136), Expect = 1e-08 Identities = 24/50 (48%), Positives = 34/50 (68%) Frame = -3 Query: 263 KGKPGKVYGQYGALSLETQAYPDAVNHPNFPSSIVRPGQVYKHDMVFRFS 114 KGK G Y ++ LETQ++PDAVN P+FP +++PG+ Y H F+FS Sbjct: 291 KGKSGAGYPKHSGFCLETQSWPDAVNQPHFPPVLLKPGEEYDHTTWFKFS 340
>GALM_PIG (Q9GKX6) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| Length = 342 Score = 55.1 bits (131), Expect = 5e-08 Identities = 24/50 (48%), Positives = 33/50 (66%) Frame = -3 Query: 263 KGKPGKVYGQYGALSLETQAYPDAVNHPNFPSSIVRPGQVYKHDMVFRFS 114 KGK G VY ++ LETQ +P+AVN P+FP +++PG+ Y H F FS Sbjct: 291 KGKTGAVYPKHSGFCLETQNWPNAVNQPHFPPVLLKPGEEYNHTTWFVFS 340
>GALM_ACICA (P05149) Aldose 1-epimerase precursor (EC 5.1.3.3) (Mutarotase)| Length = 381 Score = 51.6 bits (122), Expect = 5e-07 Identities = 25/54 (46%), Positives = 32/54 (59%) Frame = -3 Query: 269 NEKGKPGKVYGQYGALSLETQAYPDAVNHPNFPSSIVRPGQVYKHDMVFRFSYQ 108 N G G +Y Q AL+LETQ +PD+ N P FPS+ + P Q Y VF+F Q Sbjct: 327 NIVGANGVLYRQADALALETQHFPDSPNQPTFPSTRLNPNQTYNSVTVFKFGVQ 380
>GALM_STRTR (P21955) Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)| Length = 348 Score = 33.9 bits (76), Expect = 0.11 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = -3 Query: 251 GKVYGQYGALSLETQAYPDAVNHPNFPSSIVRPGQVYKHDMVFRF 117 GK+ + A+++E Q PDAVNH F I+ G +++ F++ Sbjct: 299 GKMAKRREAIAMEAQTLPDAVNHKGFGDIILDKGHSVNYEIGFQY 343
>GALM_HAEIN (P31765) Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)| Length = 340 Score = 33.9 bits (76), Expect = 0.11 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = -3 Query: 278 WLINEKGKPGKVYGQYGALSLETQAYPDAVNHPNFPS--SIVRPGQVYKHDMVFRF 117 +L + G++Y + ++LETQ PD NHP + + I + G Y F+F Sbjct: 284 YLAGTPTRNGELYADFSGIALETQCLPDTPNHPEWQNYGGIQKAGGRYYQWTEFKF 339
>GALM_SHIFL (P0A9C4) Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)| Length = 346 Score = 33.9 bits (76), Expect = 0.11 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -3 Query: 242 YGQYGALSLETQAYPDAVNHPNF--PSSIVRPGQVYKHDMVFRF 117 Y + L+LE++ PD+ NHP + P +RPG+ Y ++F Sbjct: 300 YADWQGLALESEFLPDSPNHPEWPQPDCFLRPGEEYSSLTEYQF 343
>GALM_ECOLI (P0A9C3) Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)| Length = 346 Score = 33.9 bits (76), Expect = 0.11 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -3 Query: 242 YGQYGALSLETQAYPDAVNHPNF--PSSIVRPGQVYKHDMVFRF 117 Y + L+LE++ PD+ NHP + P +RPG+ Y ++F Sbjct: 300 YADWQGLALESEFLPDSPNHPEWPQPDCFLRPGEEYSSLTEYQF 343
>GAL10_KLULA (P09609) GAL10 bifunctional protein [Includes: UDP-glucose| 4-epimerase (EC 5.1.3.2) (Galactowaldenase); Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)] Length = 688 Score = 32.3 bits (72), Expect = 0.32 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -3 Query: 242 YGQYGALSLETQAYPDAVNHPNFPSSIVRP-GQVYKHDMVFRF 117 Y + E Y DAVN+P + SS+V P G+ Y H + + F Sbjct: 643 YENRAGICCEPGRYIDAVNNPEWKSSVVLPAGETYGHKLSYTF 685
>RUMA_RALEJ (Q46ZH7) 23S rRNA (uracil-5-)-methyltransferase rumA (EC 2.1.1.-)| (23S rRNA(M-5-U1939)-methyltransferase) Length = 463 Score = 29.6 bits (65), Expect = 2.1 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -3 Query: 275 LINEKGKPGKVYGQYGALSLETQAYPDAVNHPNF 174 L+NE G PGKV GAL ET +Y P++ Sbjct: 38 LVNEDGTPGKVIFVEGALPGETVSYKSFRRKPSY 71
>YMP8_YEAST (Q04364) Protein YMR018w| Length = 514 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -3 Query: 278 WLINEKGKPGKVYGQYGALSLETQAYPDAVNHPN 177 +L+ EK G ++ +YGA+ T++Y A+N N Sbjct: 385 FLLLEKPNNGTIWNRYGAILANTKSYHSAINAYN 418
>IRK16_HUMAN (Q9NPI9) Inward rectifier potassium channel 16 (Potassium channel,| inwardly rectifying subfamily J member 16) (Inward rectifier K(+) channel Kir5.1) Length = 418 Score = 28.9 bits (63), Expect = 3.6 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Frame = +3 Query: 6 NATSYYTSY--QHVTAQSTRKRRMISHYDVSCVV--SSLVGEPEDHVV 137 NA + Y Y +H+ A+ R RR + H D SC V + GE +VV Sbjct: 12 NADAKYPGYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVV 59
>B3GT6_HUMAN (Q96L58) Beta-1,3-galactosyltransferase 6 (EC 2.4.1.134) (beta| 3GalT6) (Galactosylxylosylprotein 3-beta-galactosyltransferase) (UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6) (Galactosyltransferase II) (GAG GalTII) Length = 329 Score = 28.5 bits (62), Expect = 4.6 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = -2 Query: 267 REGEAREGVRPV---RRAVPGDAGXXXXXXXXXXXXVHREARPGVQARHGLQVLLP 109 R E R +R RR PGD R A QARHG +LLP Sbjct: 68 RAAERRSVIRSTWLARRGAPGDVWARFAVGTAGLGAEERRALEREQARHGDLLLLP 123
>ECP1_MOUSE (P97426) Eosinophil cationic protein 1 precursor (EC 3.1.27.-) (ECP| 1) (Ribonuclease 3-1) (RNase 3-1) (Eosinophil secondary granule ribonuclease 1) (EAR-1) Length = 155 Score = 27.7 bits (60), Expect = 7.9 Identities = 19/50 (38%), Positives = 24/50 (48%) Frame = +3 Query: 6 NATSYYTSYQHVTAQSTRKRRMISHYDVSCVVSSLVGEPEDHVVLVHLAG 155 N TS T+Y QS RR + +Y V+C + P VV VHL G Sbjct: 107 NITSRATNYTQCRYQS---RRSLEYYTVACDPRTPQDSPMYPVVPVHLDG 153 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,909,657 Number of Sequences: 219361 Number of extensions: 606827 Number of successful extensions: 1670 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1670 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)