| Clone Name | rbart54g10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MTC2_YEAST (P53185) Protein MTC2 | 30 | 1.7 | 2 | PUR1_DROME (Q27601) Amidophosphoribosyltransferase precursor (EC... | 28 | 5.0 | 3 | CUT_DROME (P10180) Homeobox protein cut | 28 | 6.6 |
|---|
>MTC2_YEAST (P53185) Protein MTC2| Length = 909 Score = 30.0 bits (66), Expect = 1.7 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +1 Query: 4 AHLFIHSTVHPNLLHHRNSWDTTKHNARPQPSSNEEHNARPDDGHADN 147 A++ IH +HP +LH+ N W + + N+E A DG + N Sbjct: 106 AYISIHKQLHPLILHNLNIW-------KDFMADNDEETATTTDGDSMN 146
>PUR1_DROME (Q27601) Amidophosphoribosyltransferase precursor (EC 2.4.2.14)| (Glutamine phosphoribosylpyrophosphate amidotransferase) (ATASE) (GPAT) Length = 546 Score = 28.5 bits (62), Expect = 5.0 Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 11/59 (18%) Frame = +2 Query: 41 CCTTEIHGTQPNITLDHN-----------PVATKNITLDQMTDTPIIQRQLNCEPRDIS 184 C E+H T + L HN V + + L +D+ +I + L C P D+S Sbjct: 146 CQPFEVHTTHGALALAHNGELVNNESLRREVLARGVGLSTHSDSELIAQSLCCAPEDVS 204
>CUT_DROME (P10180) Homeobox protein cut| Length = 2175 Score = 28.1 bits (61), Expect = 6.6 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +1 Query: 7 HLFIHSTVHPNLLHHRNSWDTTKHNARPQPSSNEEHNARPDDGHADN-SKTAKL*AQRHK 183 HL H +HP+ HH + T ++ P++ +N + N + TA+L A Sbjct: 718 HLHGHGLLHPSSAHHLHHQTTESNSNSSTPTAAGNNNGSNNSSSNTNANSTAQLAASLAS 777 Query: 184 QLHG 195 L+G Sbjct: 778 TLNG 781 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,569,699 Number of Sequences: 219361 Number of extensions: 341563 Number of successful extensions: 1139 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1137 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)