| Clone Name | rbart53a06 |
|---|---|
| Clone Library Name | barley_pub |
>DOT6_YEAST (P40059) Disrupter of telomere silencing protein 6| Length = 670 Score = 32.7 bits (73), Expect = 0.23 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +2 Query: 8 SQCNCTAQQVSRARIMNPHPQDTNKRNIGPIPRFRSHAFTP 130 S+C T+ S A MN P N ++I + FRS A TP Sbjct: 584 SRCTITSDTSSSAATMNRTPNSKNPQDIALLNNFRSEAITP 624
>RDRP_BPQBE (P14647) RNA-directed RNA polymerase beta chain (EC 2.7.7.48) (RNA| replicase beta chain) Length = 589 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 114 ERNLGMGPMFLLFVSCGCGFIMRARLTCWAVQLHWDT 4 +R + + P + +F G G I+R RL CW + L+ T Sbjct: 219 DRCIAIEPGWNMFFQLGIGGILRDRLRCWGIDLNDQT 255
>ENAM_HUMAN (Q9NRM1) Enamelin precursor| Length = 1142 Score = 28.9 bits (63), Expect = 3.3 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 5/36 (13%) Frame = +1 Query: 10 PMQLHCPAGQSCTHNESASTGYK-----QEEHRPHP 102 P + H PAG++ ++ S +K QEEH PHP Sbjct: 555 PAKEHFPAGRNTWDHQEISPPFKEDPGRQEEHLPHP 590
>TOP1_THEAC (Q9HM08) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| (Omega-protein) (Relaxing enzyme) (Untwisting enzyme) (Swivelase) Length = 770 Score = 28.5 bits (62), Expect = 4.3 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = -1 Query: 300 SELTRRWLGTEHYVRVIITYPV*LVRRVTPSRSVATY 190 S+ +R+LG +Y + +TYP+ + R+T + V Y Sbjct: 685 SKYGKRFLGCSNYPKCTVTYPLPQMGRITKTGEVCPY 721
>VEGFA_CANFA (Q9MYV3) Vascular endothelial growth factor A precursor (VEGF-A)| (Vascular permeability factor) (VPF) Length = 214 Score = 27.7 bits (60), Expect = 7.3 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = +1 Query: 85 EHRPHPKIPFTCVHTRSH-RPILTLI 159 EH+PH + F V+ RS+ RPI TL+ Sbjct: 33 EHKPHEVVKFMDVYQRSYCRPIETLV 58
>COPIA_DROME (P04146) Copia protein (Gag-int-pol protein) [Contains: Copia VLP| protein; Copia protease (EC 3.4.23.-)] Length = 1409 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +1 Query: 13 MQLHCPAGQSCTHNESASTGYKQEEHRPHPKIPFTCVHTRSHRPI 147 ++L C + C + + A +KQ + + H K P VH+ PI Sbjct: 448 LELSCEICEPCLNGKQARLPFKQLKDKTHIKRPLFVVHSDVCGPI 492 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,537,182 Number of Sequences: 219361 Number of extensions: 1008771 Number of successful extensions: 2292 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2253 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2292 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)