| Clone Name | rbart52a05 |
|---|---|
| Clone Library Name | barley_pub |
>PDP_BACSU (P39142) Pyrimidine-nucleoside phosphorylase (EC 2.4.2.2) (PYNP)| Length = 433 Score = 28.9 bits (63), Expect = 3.1 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = -3 Query: 224 LKNDSSLESFLSHLFWDGGSTRLVSFPALVRTATYRITTLASLAACMQQAV 72 +KN +LE F L GG + +V P+ + A Y+I A A + + V Sbjct: 300 MKNGKALEKFKDFLKNQGGDSSIVDDPSKLPQAAYQIDVPAKEAGVVSEIV 350
>TC753_ARATH (Q9STE8) Protein TOC75-3, chloroplast precursor (75 kDa translocon| at the outer-envelope-membrane of chloroplasts 3) (AtTOC75-III) Length = 818 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/44 (27%), Positives = 26/44 (59%) Frame = +2 Query: 59 KPYATQPAACTQQDSPEW*SYRLQS*PMLEMIPIEYFLRPKISD 190 K ++ PA ++ SP+W S+ L + ++++ + F + K+SD Sbjct: 131 KLFSPSPAVADEEQSPDWDSHGLPANIVVQLNKLSGFKKYKVSD 174
>GATC_BIFLO (Q8G767) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C| (EC 6.3.5.-) (Asp/Glu-ADT subunit C) Length = 99 Score = 28.1 bits (61), Expect = 5.3 Identities = 9/26 (34%), Positives = 19/26 (73%) Frame = +2 Query: 137 PMLEMIPIEYFLRPKISDSKMTQEKS 214 P +P+E +LRP ++++ +TQE++ Sbjct: 52 PTANPVPLEAYLRPDVAETPLTQEEA 77
>HRCA_LISMO (Q9S5A6) Heat-inducible transcription repressor hrcA| Length = 345 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 158 IEYFLRPKISDSKMTQE-KSHF*VTYFEMEGVEHNS 262 ++Y L+PK D Q +S F Y+EMEG+ NS Sbjct: 75 VDYLLQPKKLDKSDRQMIRSFFSENYYEMEGLIQNS 110
>HRCA_LISMF (Q71ZJ5) Heat-inducible transcription repressor hrcA| Length = 345 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 158 IEYFLRPKISDSKMTQE-KSHF*VTYFEMEGVEHNS 262 ++Y L+PK D Q +S F Y+EMEG+ NS Sbjct: 75 VDYLLQPKKLDKSDRQMIRSFFSENYYEMEGLIQNS 110
>HRCA_LISIN (Q92BN6) Heat-inducible transcription repressor hrcA| Length = 345 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 158 IEYFLRPKISDSKMTQE-KSHF*VTYFEMEGVEHNS 262 ++Y L+PK D Q +S F Y+EMEG+ NS Sbjct: 75 VDYLLQPKKLDKSDRQMIRSFFSENYYEMEGLIQNS 110
>CN130_MOUSE (Q8BU04) Protein C14orf130 homolog| Length = 425 Score = 27.7 bits (60), Expect = 6.9 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -1 Query: 160 DWYHFQHWSGLQPIGSPLWRVLLRACSRLC 71 DW+H +H + P ++ +AC R C Sbjct: 160 DWFHGRHLGAIPPESGDFQEMVCQACMRRC 189
>YDTE_SCHPO (O14219) Hypothetical protein C6B12.14c in chromosome I| Length = 154 Score = 27.7 bits (60), Expect = 6.9 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = +1 Query: 151 DTNRVLPPSQNK*LKNDSREESFLSHLL*DGGSRTQFYQ 267 DTN PSQ+ L S E+ LSH S TQ YQ Sbjct: 2 DTNLNFSPSQSNDLSTSSGYENVLSHFKQAALSVTQLYQ 40
>Y588_BUCAI (P57648) Hypothetical transport protein BU588| Length = 410 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 280 HNAASGRIVFYSLHLKVSDSKMTLLLSHF*VTYFGTEEVLDWYHFQHWSGL 128 H+ AS + YS K+ + + L + + FGT W+H Q W G+ Sbjct: 333 HSTASSWVGSYSNIAKIQATSLYLFFYYLGSSVFGTFGGFFWFHMQ-WLGI 382 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,250,462 Number of Sequences: 219361 Number of extensions: 1032357 Number of successful extensions: 2231 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2231 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)