| Clone Name | rbart50g01 |
|---|---|
| Clone Library Name | barley_pub |
>ENP1_BOVIN (O18956) Ectonucleoside triphosphate diphosphohydrolase 1 (EC| 3.6.1.5) (NTPDase1) (Ecto-ATP diphosphohydrolase) (ATPDase) (Lymphoid cell activation antigen) (CD39 antigen) (Ecto-apyrase) Length = 513 Score = 31.2 bits (69), Expect = 0.62 Identities = 11/27 (40%), Positives = 20/27 (74%), Gaps = 4/27 (14%) Frame = +1 Query: 142 KCKQALV----SSFCTYTSCTINGTFL 210 +C+Q+++ +S+C Y+SC+ NG FL Sbjct: 326 RCRQSIIQLFNTSYCPYSSCSFNGVFL 352
>T4S5_HUMAN (O14894) Transmembrane 4 L6 family member 5 (Tetraspan| transmembrane protein L6H) Length = 197 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 204 CAIDCATCIGAEATD*CLLAFVQSYVVLVLNMEVS 100 C CA C+G CL+ V + ++LV N E S Sbjct: 2 CTGKCARCVGLSLITLCLVCIVANALLLVPNGETS 36
>TLR12_MOUSE (Q6QNU9) Toll-like receptor 12 precursor| Length = 906 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -2 Query: 291 LAYLEVRFRLWMDSGLCRGDLGDRVVFEKCAIDC 190 + YL+ FR+W+ +GD G R +F+ C Sbjct: 735 IPYLQALFRVWLQGLRGKGDKGKRFLFDVFVSHC 768
>PP4R3_ASHGO (Q75E32) Serine/threonine-protein phosphatase 4 regulatory subunit| 3 (PP4R3) Length = 687 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 174 HLYKLHNQWHISRKPLCHQDLLYKVHYPSTI 266 +L+ L N +HI+ + L H+DLL H T+ Sbjct: 184 YLHTLINHFHIAEEKLLHKDLLLLSHIIKTL 214
>PCSK5_MOUSE (Q04592) Proprotein convertase subtilisin/kexin type 5 precursor (EC| 3.4.21.-) (Proprotein convertase PC5) (Subtilisin/kexin-like protease PC5) (PC6) (Subtilisin-like proprotein convertase 6) (SPC6) Length = 1877 Score = 27.3 bits (59), Expect = 9.0 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 210 EKCAIDCATCIGAEATD*CL 151 EKC+ DC +C GA+ CL Sbjct: 1256 EKCSEDCVSCSGADLCQQCL 1275
>NPY4R_HUMAN (P50391) Neuropeptide Y receptor type 4 (NPY4-R) (Pancreatic| polypeptide receptor 1) (PP1) Length = 375 Score = 27.3 bits (59), Expect = 9.0 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 171 LHLYKLHNQWHISRKPLCHQDLLYKV 248 LH++ WH P+CH +L++ V Sbjct: 281 LHVFNSLEDWHHEAIPICHGNLIFLV 306 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,822,678 Number of Sequences: 219361 Number of extensions: 983285 Number of successful extensions: 1804 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1804 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)