| Clone Name | rbart50a01 |
|---|---|
| Clone Library Name | barley_pub |
>GSTU6_ORYSA (Q06398) Probable glutathione S-transferase GSTU6 (EC 2.5.1.18) (28| kDa cold-induced protein) Length = 236 Score = 31.2 bits (69), Expect = 0.63 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = -1 Query: 384 LAAWMDRFSELDAAKAALP-EVDRVVEF 304 LAAW +RF DAAK +P + D+++EF Sbjct: 196 LAAWEERFRATDAAKGVVPDDADKLLEF 223
>OL287_RAT (P23267) Olfactory receptor 287 (Olfactory receptor-like protein| F6) Length = 311 Score = 30.0 bits (66), Expect = 1.4 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = +1 Query: 115 VQFYTRTSTKSKQIFWDRGNIIN*SLFERNMHFSYSMGLTFL*YLLVVRSNNSGSSLCLP 294 + F T K+ F RG +I+ + M+F +S+G T +LL V + + ++CLP Sbjct: 74 IWFTTACVPKTLATFAPRGGVISLAGCATQMYFVFSLGCTEY-FLLAVMAYDRYLAICLP 132 Query: 295 L 297 L Sbjct: 133 L 133
>GSTX2_MAIZE (P50472) Probable glutathione S-transferase BZ2 (EC 2.5.1.18)| (Protein bronze-2) Length = 236 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 384 LAAWMDRFSELDAAKAALPEVDRVVEF 304 L W RF+ AAK LP+ ++VV+F Sbjct: 195 LDGWSQRFAAHPAAKRVLPDTEKVVQF 221
>Y066_NPVOP (Q83949) Hypothetical 98.6 kDa protein (ORF71)| Length = 875 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 267 QQRQQLVPASSWQIRPPYQPLATPPSQHRAR*SDPSMPP 383 QQ Q P Q +PP QP PP Q P PP Sbjct: 101 QQPPQPPPDQPQQPQPPQQPPQQPPQQQPQPPQPPQQPP 139
>CRF1_YARLI (P45815) Copper resistance protein CRF1| Length = 411 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 267 QQRQQLVPASSWQIRPPYQPLATPPSQHRAR*SDPSMPP 383 QQ Q P + + P P+ATP HRA + PS+ P Sbjct: 146 QQPQMPTPVHTTNVTTP--PVATPTHSHRALSTTPSLSP 182
>OSA_DROME (Q8IN94) Trithorax group protein osa (Protein eyelid)| Length = 2716 Score = 27.3 bits (59), Expect = 9.1 Identities = 17/42 (40%), Positives = 20/42 (47%) Frame = +3 Query: 258 PK*QQRQQLVPASSWQIRPPYQPLATPPSQHRAR*SDPSMPP 383 P QQ+QQ Q +PPYQ +A PP Q P PP Sbjct: 1569 PPPQQQQQ---PQQQQQQPPYQQVAGPPGQ-----QPPQAPP 1602
>RERE_RAT (Q62901) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-related protein) Length = 1559 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 267 QQRQQLVPASSWQIRPPYQPLATPPSQHRAR 359 QQ L P PP QP+ PPSQ+ A+ Sbjct: 800 QQTPTLHPPRLPSPHPPLQPMTAPPSQNSAQ 830
>SPEG_HUMAN (Q15772) Striated muscle preferentially expressed protein kinase| (EC 2.7.11.1) (Aortic preferentially expressed protein 1) (APEG-1) Length = 3223 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 Query: 312 PPYQPLATPPSQHRAR*SDPSMP 380 PP QP ATP S HR R +P +P Sbjct: 324 PPAQPAATPTSPHR-RTQEPVLP 345 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,161,501 Number of Sequences: 219361 Number of extensions: 896406 Number of successful extensions: 2001 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1949 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1998 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)