| Clone Name | rbart49g01 |
|---|---|
| Clone Library Name | barley_pub |
>LAMA5_HUMAN (O15230) Laminin alpha-5 chain precursor| Length = 3695 Score = 30.8 bits (68), Expect = 2.4 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = -3 Query: 228 CL*HTSGPDCSSC----FSMRILRSWCMHVSCTCTPC 130 CL HT+GP C C + +L C C CTPC Sbjct: 1994 CLRHTTGPRCEICAPGFYGNALLPGNC--TRCDCTPC 2028
>LAMA5_MOUSE (Q61001) Laminin alpha-5 chain precursor| Length = 3718 Score = 30.0 bits (66), Expect = 4.0 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = -3 Query: 228 CL*HTSGPDCSSC----FSMRILRSWCMHVSCTCTPC 130 CL HT+GP C C + +L C C C+PC Sbjct: 1996 CLRHTTGPHCERCAPGFYGNALLPGNC--TRCDCSPC 2030
>AGGF1_HUMAN (Q8N302) Angiogenic factor with G patch and FHA domains 1| (Angiogenic factor VG5Q) (Vasculogenesis gene on 5q) (hVG5Q) Length = 714 Score = 28.9 bits (63), Expect = 9.0 Identities = 13/56 (23%), Positives = 30/56 (53%) Frame = +2 Query: 143 VQDTCIHQDLNIRMLKQELQSGPEVCYKQRPPRSEGPSCFRVSQAPFHRNLNRRTN 310 V+ T +++ N +K++ + G + +K PP+ P+ ++P H N++ T+ Sbjct: 302 VEHTSCNEEENFANMKKKAKIG--IHHKNSPPKVTVPTSGNTIESPLHENISNSTS 355
>LAMA_DROME (Q00174) Laminin alpha chain precursor| Length = 3712 Score = 28.9 bits (63), Expect = 9.0 Identities = 18/69 (26%), Positives = 28/69 (40%), Gaps = 7/69 (10%) Frame = -3 Query: 294 RFLWNGACETLKQEGPS----LRGGRCL*HTSGPDCSSCFSMRILRSWCMHVSC---TCT 136 R + NG +T + P + RC HT G C+ C + W + + C Sbjct: 272 RCMCNGHADTCDVKDPKSPVRILACRCQHHTCGIQCNECCPGFEQKKWRQNTNARPFNCE 331 Query: 135 PCT*FGYSS 109 PC G+S+ Sbjct: 332 PCNCHGHSN 340
>DZIP1_MOUSE (Q8BMD2) Zinc finger protein DZIP1 (DAZ-interacting protein 1| homolog) Length = 852 Score = 28.9 bits (63), Expect = 9.0 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +2 Query: 164 QDLNIRMLKQELQSGPEVCYKQRPPRSEGPSCFRVSQA 277 +D +I L++E G ++ ++ PP PSC +V +A Sbjct: 777 EDWDISSLEEEKSLGSKIEQREPPPAKRDPSCTQVQRA 814
>LAMB2_HUMAN (P55268) Laminin beta-2 chain precursor (S-laminin) (Laminin B1s| chain) Length = 1798 Score = 28.9 bits (63), Expect = 9.0 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = -3 Query: 231 RCL*HTSGPDCSSC---FSMRILRSWCMHVSCTC 139 RCL HT GP C+ C F + R C CTC Sbjct: 1009 RCLHHTEGPHCAHCKPGFHGQAARQSCHR--CTC 1040 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,136,508 Number of Sequences: 219361 Number of extensions: 1401816 Number of successful extensions: 3626 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3626 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)