| Clone Name | rbart49e03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UL49_BHV1C (P30022) Tegument protein UL49 homolog | 30 | 3.4 | 2 | DHX33_HUMAN (Q9H6R0) Putative ATP-dependent RNA helicase DHX33 (... | 28 | 7.6 | 3 | RELB_CHICK (P51509) Transcription factor RelB homolog | 28 | 7.6 | 4 | MYCN_HUMAN (P04198) N-myc proto-oncogene protein | 28 | 7.6 | 5 | GAG_MLVF5 (P26807) Gag polyprotein (Core polyprotein) [Contains:... | 28 | 9.9 |
|---|
>UL49_BHV1C (P30022) Tegument protein UL49 homolog| Length = 258 Score = 29.6 bits (65), Expect = 3.4 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +1 Query: 268 SRRGELDAAXXXXXXXXMPPLRDPVTQEDAGDGGAGRSSPPLRRPRAVPWRAGVA 432 +RR A+ PP+ P T+ +G GA PP RPRA P VA Sbjct: 91 ARRSSSRASSRPPRAAADPPVLRPATRGSSGGAGAVAVGPP--RPRAPPGANAVA 143
>DHX33_HUMAN (Q9H6R0) Putative ATP-dependent RNA helicase DHX33 (EC 3.6.1.-)| (DEAH box protein 33) Length = 707 Score = 28.5 bits (62), Expect = 7.6 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 5/41 (12%) Frame = +1 Query: 322 PPLRDPVTQEDAGDGGAG-----RSSPPLRRPRAVPWRAGV 429 PP R V AG GG G R PPL +P A P+ V Sbjct: 27 PPGRQVVMLLTAGSGGRGGGGGRRQQPPLAQPSASPYPEAV 67
>RELB_CHICK (P51509) Transcription factor RelB homolog| Length = 549 Score = 28.5 bits (62), Expect = 7.6 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 337 PVTQEDAGDGGAGRSSPPLRRPRAVPW 417 P+ + +GG GR+SP R P + W Sbjct: 514 PICSQGTSEGGGGRTSPRYRPPPPLKW 540
>MYCN_HUMAN (P04198) N-myc proto-oncogene protein| Length = 464 Score = 28.5 bits (62), Expect = 7.6 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 426 ASAPRHGPRAAEGRG*PASAAVPGV 352 ASAP GP A G G A A PGV Sbjct: 210 ASAPAAGPAVASGAGIAAPAGAPGV 234
>GAG_MLVF5 (P26807) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 538 Score = 28.1 bits (61), Expect = 9.9 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 322 PPLRDPVTQEDAGDGGAGRSSPPLRRPRAVP 414 PP RDP G+GG+G +P P + P Sbjct: 163 PPYRDPGPSSSDGNGGSGEVAPTEGAPDSSP 193 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,464,317 Number of Sequences: 219361 Number of extensions: 666883 Number of successful extensions: 1583 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1583 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)