| Clone Name | rbart48e04 |
|---|---|
| Clone Library Name | barley_pub |
>KRA98_HUMAN (Q9BYQ0) Keratin-associated protein 9-8 (Keratin-associated protein| 9.8) (Ultrahigh sulfur keratin-associated protein 9.8) Length = 159 Score = 33.9 bits (76), Expect = 0.22 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 7/70 (10%) Frame = -2 Query: 218 CSWTRRAPCCCGQTDTRAGTG-------IGRKRSGYSPTTASTGVCPGRSMPGTTCCFKS 60 CS P CCGQT + G + +R+ Y PTT C +S G++CC Sbjct: 71 CSTPCCQPTCCGQTSCGSSCGQSSSCAPVYCRRTCYHPTTVCLPGCLNQSC-GSSCCQPC 129 Query: 59 CQTSKHTEVC 30 C+ + C Sbjct: 130 CRPACCETTC 139
>YXWL_CAEEL (Q20806) Hypothetical protein F55C10.4| Length = 517 Score = 30.4 bits (67), Expect = 2.5 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -1 Query: 291 DFYTGQVDEFREAEKAAAVAGVDMVLMDTTGAMLLRPDGHPSRYGHW 151 D+ T +V E R +A V + + TG +RP+ S + HW Sbjct: 299 DYKTIKVSELRSQSLSAIVKNAERLSTKDTGKSFVRPERFNSTWSHW 345
>CP2BB_CANFA (P24460) Cytochrome P450 2B11 (EC 1.14.14.1) (CYPIIB11) (P450| PBD-2) Length = 494 Score = 30.0 bits (66), Expect = 3.2 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 222 MVLMDTTGAMLLRPDGHPSRYGHWPEEKRVL 130 ++L TG +LL GHP YGH P R L Sbjct: 7 LLLALLTGLLLLMARGHPKAYGHLPPGPRPL 37
>ENT1_HUMAN (P61550) HERV-T_19q13.11 provirus ancestral Env polyprotein| precursor (Envelope polyprotein) (HERV-T Env protein) [Includes: Surface protein (SU); Transmembrane protein (TM)] Length = 626 Score = 30.0 bits (66), Expect = 3.2 Identities = 20/38 (52%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Frame = +1 Query: 265 LVH-LPRVEVEVQVTHRRLVAPVRLHP---AAVPALVP 366 LVH LP+V V R+L+AP LHP AVP LVP Sbjct: 408 LVHVLPQVYVYSGPEGRQLIAPPELHPRLHQAVPLLVP 445
>ILVB_MYCLE (O33112) Acetolactate synthase (EC 2.2.1.6) (Acetohydroxy-acid| synthase) (ALS) Length = 625 Score = 29.6 bits (65), Expect = 4.2 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -2 Query: 158 GIGRKRSGYSPTTASTGVCPGRSMPGTT 75 G G SGY+ T GVC S PG T Sbjct: 94 GAGHAASGYAHVTGKVGVCMATSGPGAT 121
>ILVB_MYCAV (Q59498) Acetolactate synthase (EC 2.2.1.6) (Acetohydroxy-acid| synthase) (ALS) Length = 621 Score = 29.6 bits (65), Expect = 4.2 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -2 Query: 158 GIGRKRSGYSPTTASTGVCPGRSMPGTT 75 G G SGY+ T GVC S PG T Sbjct: 91 GAGHAASGYAHATGKVGVCMATSGPGAT 118
>RL4_METMA (Q8PV49) 50S ribosomal protein L4P| Length = 253 Score = 29.3 bits (64), Expect = 5.5 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -1 Query: 246 AAAVAGVDMVLMDTTGAMLLRPDGHPSRYGHWPE 145 A ++GVD+V +D+ A LL P H R W E Sbjct: 209 ARNLSGVDVVTVDSLNAELLAPGTHAGRLTVWTE 242
>RL4_METAC (Q8TRU6) 50S ribosomal protein L4P| Length = 253 Score = 29.3 bits (64), Expect = 5.5 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -1 Query: 246 AAAVAGVDMVLMDTTGAMLLRPDGHPSRYGHWPE 145 A ++GVD+V +D+ A LL P H R W E Sbjct: 209 ARNLSGVDVVTVDSLNAELLAPGTHAGRLTVWTE 242
>DPH2_CANAL (Q59SJ9) Diphthamide biosynthesis protein 2| Length = 529 Score = 29.3 bits (64), Expect = 5.5 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = -3 Query: 142 EAGTLQRLHPLVSARAGRCLERHVASNHVRLANIQRFATACFN 14 E+ T QR+ L C VA+ HVR + F AC N Sbjct: 111 ESNTAQRVWILADTSYSACCVDEVAAEHVRSDLVVHFGDACLN 153
>PABP_SCHPO (P31209) Polyadenylate-binding protein (Poly(A)-binding protein)| (PABP) Length = 653 Score = 29.3 bits (64), Expect = 5.5 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -1 Query: 270 DEFREAEKAAAVAGVDMVLMDTTGAMLLRPDGHP 169 ++FR ++ AA AG+ V TG ++ P G+P Sbjct: 457 NQFRLQQQVAAAAGIPAVQYGATGPLIYGPGGYP 490
>ILVB_MYCTU (P0A622) Acetolactate synthase (EC 2.2.1.6) (Acetohydroxy-acid| synthase) (ALS) Length = 618 Score = 29.3 bits (64), Expect = 5.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -2 Query: 158 GIGRKRSGYSPTTASTGVCPGRSMPGTT 75 G G SGY+ T GVC S PG T Sbjct: 87 GAGHAASGYAHVTGRVGVCMATSGPGAT 114
>ILVB_MYCBO (P0A623) Acetolactate synthase (EC 2.2.1.6) (Acetohydroxy-acid| synthase) (ALS) Length = 618 Score = 29.3 bits (64), Expect = 5.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -2 Query: 158 GIGRKRSGYSPTTASTGVCPGRSMPGTT 75 G G SGY+ T GVC S PG T Sbjct: 87 GAGHAASGYAHVTGRVGVCMATSGPGAT 114
>ASCL2_HUMAN (Q99929) Achaete-scute homolog 2 (HASH2)| Length = 193 Score = 28.5 bits (62), Expect = 9.4 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +3 Query: 75 CRSRHRPARADTSGCSRWRVPASLPANARTGSGVRLAA 188 C +R RPA + CSR R PA A TG G A Sbjct: 20 CAARRRPASPELLRCSRRR----RPATAETGGGAAAVA 53
>TCTP_ANOGA (Q7QCK2) Translationally-controlled tumor protein homolog (TCTP)| Length = 171 Score = 28.5 bits (62), Expect = 9.4 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -1 Query: 312 TMGDLDLDFYTGQVDEFREAEKAAAVAGVDMVL 214 T+GD+ LD +E E ++A +GVD+VL Sbjct: 38 TLGDVQLDGANPSAEEAEEGTESATESGVDIVL 70
>BDLF2_EBV (P03225) Protein BDLF2| Length = 420 Score = 28.5 bits (62), Expect = 9.4 Identities = 21/58 (36%), Positives = 25/58 (43%) Frame = +1 Query: 301 VTHRRLVAPVRLHPAAVPALVPRPSLEVRHRRERPDDDFGLHAAVIVDGPKRCPERHP 474 V RR++A A PRP R R DF + AA V GP+ PE HP Sbjct: 25 VHERRVLASGERVEVFYKAPAPRP----REGRASTFHDFTVPAAAAVPGPEPEPEPHP 78 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,227,142 Number of Sequences: 219361 Number of extensions: 1256225 Number of successful extensions: 4335 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 4127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4332 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)