| Clone Name | rbart46b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SCNNH_XENLA (O13263) Amiloride-sensitive sodium channel gamma-2-... | 32 | 0.58 | 2 | AMD_MOUSE (P97467) Peptidyl-glycine alpha-amidating monooxygenas... | 28 | 4.9 |
|---|
>SCNNH_XENLA (O13263) Amiloride-sensitive sodium channel gamma-2-subunit| (Epithelial Na(+) channel gamma-2 subunit) (Gamma-2 ENAC) (Nonvoltage-gated sodium channel 1 gamma-2 subunit) (SCNEG2) (Gamma-2 NACH) Length = 663 Score = 31.6 bits (70), Expect = 0.58 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +2 Query: 5 NMPHYYFCSINNFNTCTKWTIGKGISANLEHGNVYYS*V*AR 130 NM + C NN + CT +T G G++A E ++Y+ + A+ Sbjct: 202 NMVGFKLCDANNSSDCTIFTFGSGVNAIQEWYRLHYNNILAK 243
>AMD_MOUSE (P97467) Peptidyl-glycine alpha-amidating monooxygenase precursor| (EC 1.14.17.3) (PAM) Length = 979 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +3 Query: 111 IHKYRR-ERTPTNQHARALAFKHPHIRPWRP 200 IHK+ R E T +RAL+F+ P PW P Sbjct: 463 IHKFHRLESTLRPAESRALSFQQPGEGPWEP 493 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,921,793 Number of Sequences: 219361 Number of extensions: 590874 Number of successful extensions: 1339 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1339 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)