| Clone Name | rbart45a09 |
|---|---|
| Clone Library Name | barley_pub |
>ORYB_ORYSA (P25777) Oryzain beta chain precursor (EC 3.4.22.-)| Length = 471 Score = 156 bits (394), Expect = 4e-38 Identities = 66/73 (90%), Positives = 69/73 (94%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLS 342 PAGSTCCC+FGFRNLCLVWGCCP EGATCCKDH+SCCPPDYPVCN RAGTCSA+KNSPLS Sbjct: 392 PAGSTCCCAFGFRNLCLVWGCCPVEGATCCKDHASCCPPDYPVCNTRAGTCSASKNSPLS 451 Query: 341 VKALKRTLAMRNT 303 VKALKRTLA NT Sbjct: 452 VKALKRTLAKLNT 464
>CYSP1_ORYSA (Q7XR52) Cysteine protease 1 precursor (EC 3.4.22.-) (OsCP1)| Length = 490 Score = 117 bits (294), Expect = 1e-26 Identities = 43/62 (69%), Positives = 54/62 (87%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLS 342 PAG+TCCC++G RN C+VWGCCP EGATCCKDHS+CCP +YPVCN +A TCS +KNSP + Sbjct: 402 PAGTTCCCNYGIRNHCIVWGCCPVEGATCCKDHSTCCPKEYPVCNAKARTCSKSKNSPYN 461 Query: 341 VK 336 ++ Sbjct: 462 IR 463
>CYSPL_LYCES (P20721) Low-temperature-induced cysteine proteinase precursor (EC| 3.4.22.-) (Fragment) Length = 346 Score = 116 bits (291), Expect = 3e-26 Identities = 49/81 (60%), Positives = 56/81 (69%) Frame = -2 Query: 515 GSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVK 336 G+TCCC FR C WGCCP EGATCC+DH SCCP DYP+CN+R GTCS +K +PL VK Sbjct: 265 GTTCCCILQFRRSCFSWGCCPLEGATCCEDHYSCCPHDYPICNVRQGTCSMSKGNPLGVK 324 Query: 335 ALKRTLAMRNTA*SRRGKAVS 273 A+KR LA A GK S Sbjct: 325 AMKRILAQPIGAFGNGGKKSS 345
>ORYA_ORYSA (P25776) Oryzain alpha chain precursor (EC 3.4.22.-)| Length = 458 Score = 112 bits (281), Expect = 5e-25 Identities = 44/72 (61%), Positives = 53/72 (73%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLS 342 P +TCCC + + C WGCCP EGATCC DH SCCP +YP+CN++ GTC K+SPL+ Sbjct: 374 PDSTTCCCIYEYGKYCYAWGCCPLEGATCCDDHYSCCPHEYPICNVQQGTCLMAKDSPLA 433 Query: 341 VKALKRTLAMRN 306 VKALKRTLA N Sbjct: 434 VKALKRTLAKPN 445
>RD21A_ARATH (P43297) Cysteine proteinase RD21a precursor (EC 3.4.22.-) (RD21)| Length = 462 Score = 102 bits (254), Expect = 6e-22 Identities = 40/66 (60%), Positives = 47/66 (71%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLS 342 P +TCCC F + C WGCCP E ATCC D+ SCCP +YPVC++ GTC +KNSP S Sbjct: 382 PESNTCCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFS 441 Query: 341 VKALKR 324 VKALKR Sbjct: 442 VKALKR 447
>GRN_HUMAN (P28799) Granulins precursor (Proepithelin) (PEPI) [Contains:| Acrogranin; Paragranulin; Granulin-1 (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Granulin B); Granulin-4 (Granulin A); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granul Length = 593 Score = 52.8 bits (125), Expect = 6e-07 Identities = 22/51 (43%), Positives = 26/51 (50%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 369 P G TCC S G W CC A CC+D CCP Y CN++A +C Sbjct: 451 PVGQTCCPSLGGS-----WACCQLPHAVCCEDRQHCCPAGY-TCNVKARSC 495 Score = 52.8 bits (125), Expect = 6e-07 Identities = 23/51 (45%), Positives = 27/51 (52%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 369 P G TCC R WGCCP A CC+DH CCP + C+ + GTC Sbjct: 291 PDGYTCC-----RLQSGAWGCCPFTQAVCCEDHIHCCPAGF-TCDTQKGTC 335 Score = 52.0 bits (123), Expect = 1e-06 Identities = 24/57 (42%), Positives = 31/57 (54%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNS 351 P GSTCC + +GCCP ATCC DH CCP D VC++ C + +N+ Sbjct: 216 PDGSTCCELPSGK-----YGCCPMPNATCCSDHLHCCPQD-TVCDLIQSKCLSKENA 266 Score = 46.2 bits (108), Expect = 5e-05 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDY 399 P+ TCC WGCCP A CC DH CCP Y Sbjct: 373 PSSDTCCQLTSGE-----WGCCPIPEAVCCSDHQHCCPQGY 408 Score = 41.6 bits (96), Expect = 0.001 Identities = 23/63 (36%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC-SATKNSPL 345 P STCC WGCCP A+CC+D CCP C++ C + T PL Sbjct: 134 PDFSTCCVMVDGS-----WGCCPMPQASCCEDRVHCCPHG-AFCDLVHTRCITPTGTHPL 187 Query: 344 SVK 336 + K Sbjct: 188 AKK 190 Score = 38.5 bits (88), Expect = 0.011 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 4/68 (5%) Frame = -2 Query: 509 TCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATK----NSPLS 342 TCC R+ W CCP CC D CCP + C R C + ++PL Sbjct: 532 TCC-----RDNRQGWACCPYRQGVCCADRRHCCPAGFR-CAARGTKCLRREAPRWDAPLR 585 Query: 341 VKALKRTL 318 AL++ L Sbjct: 586 DPALRQLL 593 Score = 28.9 bits (63), Expect = 9.0 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = -2 Query: 500 CSFGFRNLCLVWG---CCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 369 CS G + V G CCP A C D CCP + C+ +C Sbjct: 67 CSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFH-CSADGRSC 112
>GRN_MOUSE (P28798) Granulins precursor (Proepithelin) (PEPI) (PC cell-derived| growth factor) (PCDGF) [Contains: Acrogranin; Granulin-1; Granulin-2; Granulin-3; Granulin-4; Granulin-5; Granulin-6; Granulin-7] Length = 589 Score = 52.4 bits (124), Expect = 8e-07 Identities = 27/69 (39%), Positives = 34/69 (49%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLS 342 P G TCC R WGCCP A CC+DH CCP + C+ GTC + L Sbjct: 289 PEGYTCC-----RLNTGAWGCCPFAKAVCCEDHIHCCPAGFQ-CHTEKGTC---EMGILQ 339 Query: 341 VKALKRTLA 315 V +K+ +A Sbjct: 340 VPWMKKVIA 348 Score = 51.6 bits (122), Expect = 1e-06 Identities = 23/51 (45%), Positives = 26/51 (50%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 369 P G TCC S L W CC A CC+D CCP Y CN++A TC Sbjct: 449 PVGQTCCPS-----LKGSWACCQLPHAVCCEDRQHCCPAGY-TCNVKARTC 493 Score = 43.9 bits (102), Expect = 3e-04 Identities = 21/51 (41%), Positives = 25/51 (49%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 369 P STCC + +GCCP A CC DH CCP D VC++ C Sbjct: 215 PDDSTCCELPTGK-----YGCCPMPNAICCSDHLHCCPQD-TVCDLIQSKC 259 Score = 41.2 bits (95), Expect = 0.002 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDY 399 P +TCC + WGCCP A CC D+ CCP + Sbjct: 371 PTNNTCC-----KLNSGDWGCCPIPEAVCCSDNQHCCPQGF 406 Score = 41.2 bits (95), Expect = 0.002 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCP 408 P +TCC WGCCP A+CC+D CCP Sbjct: 133 PDSATCCIMVDGS-----WGCCPMPQASCCEDRVHCCP 165 Score = 39.7 bits (91), Expect = 0.005 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = -2 Query: 509 TCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATK 357 TCC ++ VW CCP CC+D CCP + C+ R C K Sbjct: 528 TCC-----KDSAGVWACCPYLKGVCCRDGRHCCPGGFH-CSARGTKCLRKK 572 Score = 31.6 bits (70), Expect = 1.4 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Frame = -2 Query: 500 CSFGFRNLCLVWG---CCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPL 345 C G+ L V G CCP C D CCP + C+ +C ++PL Sbjct: 67 CPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFH-CSADGKSCFQMSDNPL 120
>GRN_RAT (P23785) Granulins precursor [Contains: Acrogranin; Granulin-1| (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Granulin B) (Epithelin-2); Granulin-4 (Granulin A) (Epithelin-1); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granulin-7 (Gran Length = 588 Score = 52.0 bits (123), Expect = 1e-06 Identities = 24/57 (42%), Positives = 27/57 (47%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNS 351 P G TCC S L W CC A CC+D CCP Y CN++A TC S Sbjct: 448 PVGQTCCPS-----LKGSWACCQLPHAVCCEDRQHCCPAGY-TCNVKARTCEKDAGS 498 Score = 52.0 bits (123), Expect = 1e-06 Identities = 23/51 (45%), Positives = 26/51 (50%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 369 P G TCC R WGCCP A CC+DH CCP + C+ GTC Sbjct: 288 PDGYTCC-----RLNTGAWGCCPFTKAVCCEDHIHCCPAGFQ-CHTETGTC 332 Score = 45.1 bits (105), Expect = 1e-04 Identities = 18/41 (43%), Positives = 21/41 (51%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDY 399 P+ +TCC R WGCCP A CC DH CCP + Sbjct: 370 PSNNTCC-----RLSSGDWGCCPMPEAVCCLDHQHCCPQGF 405 Score = 43.9 bits (102), Expect = 3e-04 Identities = 21/51 (41%), Positives = 25/51 (49%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 369 P STCC + +GCCP A CC DH CCP D VC++ C Sbjct: 214 PDDSTCCELPTGK-----YGCCPMPNAICCSDHLHCCPQD-TVCDLIQSKC 258 Score = 42.7 bits (99), Expect = 6e-04 Identities = 21/62 (33%), Positives = 25/62 (40%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLS 342 P +TCC WGCCP A+CC+D CCP + S T PL Sbjct: 133 PDSATCCIMIDGS-----WGCCPMPQASCCEDRVHCCPHGASCDLVHTRCISPTGTHPLL 187 Query: 341 VK 336 K Sbjct: 188 KK 189 Score = 35.4 bits (80), Expect = 0.096 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -2 Query: 467 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATK 357 W CCP CC+D CCP + C+ + C K Sbjct: 536 WACCPYVKGVCCRDGRHCCPIGFH-CSAKGTKCLRKK 571 Score = 31.6 bits (70), Expect = 1.4 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Frame = -2 Query: 500 CSFGFRNLCLVWG---CCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPL 345 C G+ L V G CCP C D CCP + C+ +CS +S L Sbjct: 67 CPDGYSCLLTVSGTSSCCPFSEGVSCDDGQHCCPRGFH-CSADGKSCSQISDSLL 120
>GRN_CAVPO (P28797) Granulins precursor (Proepithelin) (PEPI) [Contains:| Acrogranin; Granulin-1; Granulin-2; Granulin-3; Granulin-4; Granulin-5; Granulin-6; Granulin-7] (Fragment) Length = 591 Score = 48.9 bits (115), Expect = 8e-06 Identities = 22/51 (43%), Positives = 25/51 (49%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 369 P G TCC R WGCCP A CC+DH CCP + C+ TC Sbjct: 290 PEGQTCC-----RLQSGKWGCCPFPKAVCCEDHVHCCPERFR-CHTEKDTC 334 Score = 47.8 bits (112), Expect = 2e-05 Identities = 21/51 (41%), Positives = 25/51 (49%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 369 P +TCC +GCCP A CC DH CCP D VC++R C Sbjct: 216 PDDTTCCLLASGE-----YGCCPMPNAICCSDHLHCCPQD-TVCDLRQSRC 260 Score = 47.0 bits (110), Expect = 3e-05 Identities = 20/51 (39%), Positives = 24/51 (47%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 369 P TCC G W CC A CC+D CCP Y CN++A +C Sbjct: 448 PVRQTCCPKLGGG-----WACCQLPHAVCCEDGQHCCPAGY-TCNVKARSC 492 Score = 44.3 bits (103), Expect = 2e-04 Identities = 22/62 (35%), Positives = 28/62 (45%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLS 342 P STCC L WGCCP A+CC+D CCP + +A + PL+ Sbjct: 120 PDSSTCC-----HMLDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHIRCVTALGSHPLT 174 Query: 341 VK 336 K Sbjct: 175 TK 176 Score = 40.0 bits (92), Expect = 0.004 Identities = 25/67 (37%), Positives = 29/67 (43%) Frame = -2 Query: 509 TCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVKAL 330 TCC R+ W CCP CCKD CCP + C + GT K S L +L Sbjct: 529 TCC-----RDSRGGWACCPFHQGVCCKDQRHCCPAGFH-CESQ-GTRCVHKKSLLHWDSL 581 Query: 329 KRTLAMR 309 R A R Sbjct: 582 PRPAAPR 588 Score = 32.3 bits (72), Expect = 0.81 Identities = 18/54 (33%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWG---CCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 369 P S C G + G CCP A C D CCP + C+ GTC Sbjct: 46 PCQSPANCPIGHSCVLTAAGTAACCPFSQAMACGDGHHCCPYGFH-CSTDGGTC 98
>GRN3_CYPCA (P81015) Granulin-3| Length = 57 Score = 40.0 bits (92), Expect = 0.004 Identities = 19/42 (45%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -2 Query: 521 PAGSTCCCS-FGFRNLCLVWGCCPAEGATCCKDHSSCCPPDY 399 P+G+TCC S FG VW CCP CC+D CC Y Sbjct: 11 PSGTTCCRSPFG------VWYCCPFLMGQCCRDGRHCCRHGY 46
>GRN1_CYPCA (P81013) Granulin-1| Length = 57 Score = 39.3 bits (90), Expect = 0.007 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -2 Query: 521 PAGSTCCCS-FGFRNLCLVWGCCPAEGATCCKDHSSCCPPDY 399 P G+TCC S +G VW CCP CC+D CC Y Sbjct: 11 PDGTTCCLSPYG------VWYCCPFSMGQCCRDGIHCCRHGY 46
>GRN2_CYPCA (P81014) Granulin-2| Length = 57 Score = 37.0 bits (84), Expect = 0.033 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -2 Query: 521 PAGSTCCCS-FGFRNLCLVWGCCPAEGATCCKDHSSCCPPDY 399 P+ +TCC S FG VW CCP CC+D CC Y Sbjct: 11 PSRTTCCRSPFG------VWYCCPFLMGQCCRDGRHCCRHGY 46
>MCSP_HUMAN (P49901) Sperm mitochondrial-associated cysteine-rich protein| Length = 116 Score = 34.7 bits (78), Expect = 0.16 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 7/70 (10%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWG---CCPAEGATCC-KDHSSCCPPDYPVCNIRAGTC---SA 363 P + CC S G N C CC +G+ CC H+ CC P P C I+A C + Sbjct: 21 PQQNQCCQSKG--NQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCC-IQARCCGLETK 77 Query: 362 TKNSPLSVKA 333 + SPL++++ Sbjct: 78 PEVSPLNMES 87 Score = 30.0 bits (66), Expect = 4.0 Identities = 14/47 (29%), Positives = 19/47 (40%), Gaps = 10/47 (21%) Frame = -2 Query: 461 CCPAEGATCCKDH---------SSCCPP-DYPVCNIRAGTCSATKNS 351 CCPA+G CC + CCPP C + C K++ Sbjct: 10 CCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHN 56
>KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-associated protein| 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 34.7 bits (78), Expect = 0.16 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCP--AEGATCCK---DHSSCCPP 405 CCCS G + C CC ++CCK SSCC P Sbjct: 135 CCCSSGCGSSCCQSSCCKPSCSQSSCCKPCCSQSSCCKP 173 Score = 33.9 bits (76), Expect = 0.28 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNI 384 CCCS G + C CC C SSCC P C I Sbjct: 203 CCCSSGCGSSCCQSSCCKP-----CSSQSSCCVPICCQCKI 238 Score = 32.7 bits (73), Expect = 0.62 Identities = 18/55 (32%), Positives = 22/55 (40%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLS 342 CCCS G + C CC CC SSCC P + C ++ P S Sbjct: 174 CCCSSGCGSSCCQSSCC----KPCC-SQSSCCKPCCCSSGCGSSCCQSSCCKPCS 223 Score = 31.2 bits (69), Expect = 1.8 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 6/55 (10%) Frame = -2 Query: 515 GSTCCCSFGFRNLCLVWGCC------PAEGATCCKDHSSCCPPDYPVCNIRAGTC 369 GS+CC S + C CC G++CC+ SSCC P C+ ++ C Sbjct: 181 GSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQ--SSCCKP----CSSQSSCC 229 Score = 29.6 bits (65), Expect = 5.3 Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 6/51 (11%) Frame = +2 Query: 302 PCFASPGCASKPSRSAGCSWSLSKS---QP*CCRRG---SPVGSSWNDPCS 436 PC S GC S +S+ C S+S +P CC G S SS PCS Sbjct: 173 PCCCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPCS 223
>CVP5_PIMHY (Q8T0W1) Cysteine-rich venom protein 5 precursor| Length = 115 Score = 34.3 bits (77), Expect = 0.21 Identities = 25/89 (28%), Positives = 37/89 (41%) Frame = -2 Query: 458 CPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVKALKRTLAMRNTA*SRRGKA 279 C + GA+C ++CC VCN+ C A P++ + +RT R T RG Sbjct: 26 CSSMGASCQIGSATCCG----VCNVHTLRCEARIGPPINTQPTRRTQPTRRT----RGPK 77 Query: 278 VSKVE*KDAAVWSFSPSCTPTNLCSKFKP 192 V++ S PTN + KP Sbjct: 78 VTR-------------SSRPTNRTRRPKP 93
>KRA54_HUMAN (Q6L8H1) Keratin-associated protein 5-4 (Keratin-associated protein| 5.4) (Ultrahigh sulfur keratin-associated protein 5.4) Length = 288 Score = 33.5 bits (75), Expect = 0.36 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 6/40 (15%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCC------PAEGATCCKDHSSCCPP 405 CCCS G + C CC G++CC+ SSCC P Sbjct: 205 CCCSSGCGSSCCQSSCCKPCCSSSGCGSSCCQ--SSCCKP 242 Score = 30.0 bits (66), Expect = 4.0 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 6/43 (13%) Frame = -2 Query: 515 GSTCCCSFGFRNLCLVWGCC------PAEGATCCKDHSSCCPP 405 GS+CC S + C CC G++CC+ SSCC P Sbjct: 231 GSSCCQSSCCKPYCCQSSCCKPCCSSSGCGSSCCQ--SSCCNP 271 Score = 28.9 bits (63), Expect = 9.0 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNI 384 CC S G + C CC CC SSCC P C I Sbjct: 253 CCSSSGCGSSCCQSSCCNP----CCSQ-SSCCVPVCCQCKI 288
>KRA51_HUMAN (Q6L8H4) Keratin-associated protein 5-1 (Keratin-associated protein| 5.1) (Ultrahigh sulfur keratin-associated protein 5.1) Length = 278 Score = 33.1 bits (74), Expect = 0.48 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNI 384 CCCS G + C CC CC SSCC P C I Sbjct: 243 CCCSSGCGSSCCQSSCCKP----CCSQ-SSCCVPVCCQCKI 278
>KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-associated protein| 5.8) (Ultrahigh sulfur keratin-associated protein 5.8) (Keratin, ultra high-sulfur matrix protein B) (UHS keratin B) (UHS KerB) Length = 187 Score = 33.1 bits (74), Expect = 0.48 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNI 384 CCCS G + C CC CC SSCC P C I Sbjct: 152 CCCSSGCGSSCCQSSCCKP----CCSQ-SSCCVPICCQCKI 187 Score = 32.7 bits (73), Expect = 0.62 Identities = 18/48 (37%), Positives = 22/48 (45%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSA 363 CCCS G + C CC CC SSCC P C+ +G S+ Sbjct: 94 CCCSSGCGSSCCQSSCC----KPCC-SQSSCCKP----CSCSSGCGSS 132 Score = 30.4 bits (67), Expect = 3.1 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 6/43 (13%) Frame = -2 Query: 515 GSTCCCSFGFRNLCLVWGCC-PAE-----GATCCKDHSSCCPP 405 GS+CC S + C CC P G++CC+ SSCC P Sbjct: 101 GSSCCQSSCCKPCCSQSSCCKPCSCSSGCGSSCCQ--SSCCKP 141
>KRA57_HUMAN (Q6L8G8) Keratin-associated protein 5-7 (Keratin-associated protein| 5.7) (Ultrahigh sulfur keratin-associated protein 5.7) (Keratin-associated protein 5-3) (Keratin-associated protein 5.3) Length = 165 Score = 32.7 bits (73), Expect = 0.62 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNI 384 CCCS G + C CC CC SSCC P C I Sbjct: 130 CCCSSGCGSSCCQSSCCNP----CCSQ-SSCCVPVCCQCKI 165 Score = 32.3 bits (72), Expect = 0.81 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPP 405 CCCS G + C CC CC+ SSCC P Sbjct: 101 CCCSSGCGSSCCQSSCCK---PCCCQ--SSCCKP 129
>PMD1_LOCMI (P80059) Pars intercerebralis major peptide D1 (PMP-D1)| Length = 54 Score = 32.7 bits (73), Expect = 0.62 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCP 408 P TCC + GCCP + CC D CCP Sbjct: 8 PGTETCCTTPQGEE-----GCCPYKEGVCCLDGIHCCP 40
>MCSP_MOUSE (P15265) Sperm mitochondrial-associated cysteine-rich protein| Length = 143 Score = 32.3 bits (72), Expect = 0.81 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKN 354 P +TC C L CCP + +CC +CCP P C TC +++N Sbjct: 61 PCPATCPCP-------LKPPCCPQK-CSCCPKKCTCCPQPPPCC--AQPTCCSSEN 106 Score = 30.4 bits (67), Expect = 3.1 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -2 Query: 461 CCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 369 CCP + C K S CCPP P C + C Sbjct: 26 CCPQKPPCCPK--SPCCPPKSPCCPPKPCPC 54
>YDB4_SCHPO (Q10357) Hypothetical protein C22E12.04 in chromosome I| Length = 297 Score = 32.0 bits (71), Expect = 1.1 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -2 Query: 503 CCSFGFRNLCLVW--GCCPAEGATCC-KDHSSCCPPDYPVC 390 CCS + C GCC E +CC ++ SCC + P C Sbjct: 247 CCSSKKPSCCSQEKKGCCSTEKTSCCSQEKKSCCTSEKPSC 287
>KRA52_HUMAN (Q701N4) Keratin-associated protein 5-2 (Keratin-associated protein| 5.2) (Ultrahigh sulfur keratin-associated protein 5.2) (Keratin-associated protein 5-8) (Keratin-associated protein 5.8) Length = 177 Score = 32.0 bits (71), Expect = 1.1 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPP 405 CCCS G + C CC CC+ SSCC P Sbjct: 122 CCCSSGCGSSCCQSSCCK---PCCCQ--SSCCVP 150 Score = 29.3 bits (64), Expect = 6.9 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 5/49 (10%) Frame = -2 Query: 515 GSTCCCSFGFRNLCLVWGCCPAE--GATCCKD---HSSCCPPDYPVCNI 384 GS+CC S + C CC ++CCK S+CC P C I Sbjct: 129 GSSCCQSSCCKPCCCQSSCCVPVCCQSSCCKPCCCQSNCCVPVCCQCKI 177
>KRA55_HUMAN (Q701N2) Keratin-associated protein 5-5 (Keratin-associated protein| 5.5) (Ultrahigh sulfur keratin-associated protein 5.5) (Keratin-associated protein 5-11) (Keratin-associated protein 5.11) Length = 221 Score = 32.0 bits (71), Expect = 1.1 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPP 405 CCCS G + C CC CC+ SSCC P Sbjct: 157 CCCSSGCGSSCCQSSCCK---PYCCQ--SSCCKP 185 Score = 29.3 bits (64), Expect = 6.9 Identities = 19/58 (32%), Positives = 24/58 (41%), Gaps = 14/58 (24%) Frame = -2 Query: 515 GSTCCCSFGFRNLCLVWGCC-PAE-----GATCCKD--------HSSCCPPDYPVCNI 384 GS+CC S + C CC P G++CC+ SSCC P C I Sbjct: 164 GSSCCQSSCCKPYCCQSSCCKPCSCFSGCGSSCCQSSCYKPCCCQSSCCVPVCCQCKI 221
>NICE1_HUMAN (Q9UGL9) Protein NICE-1| Length = 99 Score = 32.0 bits (71), Expect = 1.1 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 8/45 (17%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCC--------KDHSSCC 411 PA S+ CC G R C GCC + +CC + S CC Sbjct: 33 PASSSSCCGSG-RGCCGDSGCCGSSSTSCCCFPRRRRRQRSSGCC 76
>KR171_HUMAN (Q9BYP8) Keratin-associated protein 17-1 (Keratin associated| protein 16.1) Length = 105 Score = 32.0 bits (71), Expect = 1.1 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 464 GCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 369 GCCP + TCC +CC C + G C Sbjct: 2 GCCPGDCFTCCTQEQNCCEE----CCCQPGCC 29
>KRA59_HUMAN (P26371) Keratin-associated protein 5-9 (Keratin-associated protein| 5.9) (Ultrahigh sulfur keratin-associated protein 5.9) (Keratin, cuticle, ultrahigh sulfur 1) (Keratin, ultra high-sulfur matrix protein A) (UHS keratin A) (UHS KerA) Length = 169 Score = 31.6 bits (70), Expect = 1.4 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 16/50 (32%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCC----------------PAEGATCCKDHSSCCPP 405 CCCS G + C CC G++CC+ SSCC P Sbjct: 86 CCCSSGCGSSCCQCSCCKPYCSQCSCCKPCCSSSGRGSSCCQ--SSCCKP 133
>KR105_HUMAN (P60370) Keratin-associated protein 10-5 (Keratin-associated| protein 10.5) (High sulfur keratin-associated protein 10.5) (Keratin-associated protein 18-5) (Keratin-associated protein 18.5) Length = 271 Score = 31.6 bits (70), Expect = 1.4 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = -2 Query: 509 TCCCSFGFRNLCLVWGCCPAEGA--TCCKDHSSCC 411 TCC S + C V CC TC +D SSCC Sbjct: 119 TCCASSSCQQSCCVPVCCKPVCCVPTCSEDSSSCC 153 Score = 30.8 bits (68), Expect = 2.4 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGA--TCCKDHSSCC 411 CC S + C V CC TC KD SSCC Sbjct: 78 CCASSPCQQACCVPVCCKPVCCLPTCSKDSSSCC 111
>KRA48_HUMAN (Q9BYQ9) Keratin-associated protein 4-8 (Keratin-associated protein| 4.8) (Ultrahigh sulfur keratin-associated protein 4.8) (Fragment) Length = 114 Score = 30.8 bits (68), Expect = 2.4 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -2 Query: 509 TCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPD--YPVCNI 384 +CC S R C V CC + CC+ S CC P +P C+I Sbjct: 22 SCCISSCCRPSCCVSSCCKPQ---CCQ--SVCCQPTCCHPSCSI 60
>KR109_HUMAN (P60411) Keratin-associated protein 10-9 (Keratin-associated| protein 10.9) (High sulfur keratin-associated protein 10.9) (Keratin-associated protein 18-9) (Keratin-associated protein 18.9) Length = 292 Score = 30.8 bits (68), Expect = 2.4 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 11/49 (22%) Frame = -2 Query: 518 AGSTCCCSFGFRNLCLVWGCC-----------PAEGATCCKDHSSCCPP 405 A S CC G + C CC P CC SSCC P Sbjct: 205 ASSLCCQQSGCQPACCTTSCCRPSSSVSLLCRPVCRPACCVPVSSCCAP 253
>KR101_HUMAN (P60331) Keratin-associated protein 10-1 (Keratin-associated| protein 10.1) (High sulfur keratin-associated protein 10.1) (Keratin-associated protein 18-1) (Keratin-associated protein 18.1) Length = 282 Score = 30.4 bits (67), Expect = 3.1 Identities = 20/74 (27%), Positives = 26/74 (35%), Gaps = 11/74 (14%) Frame = -2 Query: 518 AGSTCCCSFGFRNLCLVWGCC-----------PAEGATCCKDHSSCCPPDYPVCNIRAGT 372 A ++CC + C CC P CC SSCC P A + Sbjct: 206 ASTSCCQQSSCQPACCTTSCCRPSSSVSLLCRPVCRPACCMPVSSCCAP--------ASS 257 Query: 371 CSATKNSPLSVKAL 330 C A+ P S +L Sbjct: 258 CQASCCRPASCVSL 271 Score = 30.4 bits (67), Expect = 3.1 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -2 Query: 509 TCCCSFGFRNLCLVWGCCP--AEGATCCKDHSSCCPPD--YPVC 390 TCC S + C V CC TC + SSCC +P C Sbjct: 130 TCCASSSSQQSCCVPVCCKPVCYVPTCSESSSSCCQQSSCHPAC 173 Score = 29.3 bits (64), Expect = 6.9 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGA--TCCKDHSSCC 411 CC S + C + CC TC KD SSCC Sbjct: 89 CCTSSPCQQACCMPVCCKPVCCLPTCSKDSSSCC 122
>KR412_HUMAN (Q9BQ66) Keratin-associated protein 4-12 (Keratin-associated| protein 4.12) (Ultrahigh sulfur keratin-associated protein 4.12) Length = 201 Score = 30.4 bits (67), Expect = 3.1 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 512 STCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPD--YPVCNIRAGTC 369 +TCC + R C V CC + CC+ S CC P P C I + C Sbjct: 108 TTCCRTTCCRPSCCVSSCCRPQ---CCQ--SVCCQPTCCRPSCCISSSCC 152
>HUTU_STRCO (Q9KZ75) Urocanate hydratase (EC 4.2.1.49) (Urocanase)| (Imidazolonepropionate hydrolase) Length = 572 Score = 30.4 bits (67), Expect = 3.1 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -1 Query: 342 REGFEAHPGDAKHGMKSSRE 283 REG EAH GDA HG ++RE Sbjct: 549 REGDEAHEGDAAHGSGAARE 568
>KR106_HUMAN (P60371) Keratin-associated protein 10-6 (Keratin-associated| protein 10.6) (High sulfur keratin-associated protein 10.6) (Keratin-associated protein 18-6) (Keratin-associated protein 18.6) Length = 365 Score = 30.4 bits (67), Expect = 3.1 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = -2 Query: 509 TCCCSFGFRNLCLVWGCCPAEGA--TCCKDHSSCC 411 TCC S + C V CC TC +D SSCC Sbjct: 217 TCCTSSPCQQACCVPVCCVPVCCVPTCSEDSSSCC 251 Score = 29.6 bits (65), Expect = 5.3 Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Frame = -2 Query: 518 AGSTCCCSFGFRNLCLVWGCCPAEGATCCKDH----SSCCPPDYPVCNIRAGTC 369 A ++CC + C CC + + H S+CC P P C A +C Sbjct: 278 ASTSCCQQSSCQPACCTASCCRSSSSVSLLCHPVCKSTCCVP-VPSCGASASSC 330
>LCE3B_HUMAN (Q5TA77) Late cornified envelope protein 3B (Late envelope protein| 14) Length = 95 Score = 30.4 bits (67), Expect = 3.1 Identities = 20/64 (31%), Positives = 25/64 (39%), Gaps = 7/64 (10%) Frame = +2 Query: 224 CRREKSSTQPHPSIPP*T--PLSLDDFMP-----CFASPGCASKPSRSAGCSWSLSKSQP 382 C++ + QP P P P S +P C PGC PS GC S + Sbjct: 3 CQQNQQQCQPLPKCPSPKCPPKSSAQCLPPASSCCAPRPGCCGGPSSEGGCCLSHHR--- 59 Query: 383 *CCR 394 CCR Sbjct: 60 -CCR 62
>ENA1_HORSE (P80930) Antimicrobial peptide eNAP-1 (Fragment)| Length = 46 Score = 30.4 bits (67), Expect = 3.1 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -2 Query: 461 CCPAEGATCCKDHSSCCP 408 CCP CC D CCP Sbjct: 26 CCPYSQGVCCADQRHCCP 43
>KR414_HUMAN (Q9BYQ6) Keratin-associated protein 4-14 (Keratin-associated| protein 4.14) (Ultrahigh sulfur keratin-associated protein 4.14) Length = 195 Score = 30.0 bits (66), Expect = 4.0 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPD--YPVCNI 384 CC S R C V CC + CC+ S CC P +P C+I Sbjct: 104 CCISSCCRPSCCVSSCCRPQ---CCQ--SVCCQPTCCHPSCSI 141
>NPT2B_MOUSE (Q9DBP0) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 697 Score = 30.0 bits (66), Expect = 4.0 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKD 426 CCC R C+V GC + CC+D Sbjct: 620 CCCRVCCRVCCMVCGCKCCRCSKCCRD 646
>KR102_HUMAN (P60368) Keratin-associated protein 10-2 (Keratin-associated| protein 10.2) (High sulfur keratin-associated protein 10.2) (Keratin-associated protein 18-2) (Keratin-associated protein 18.2) Length = 255 Score = 30.0 bits (66), Expect = 4.0 Identities = 19/64 (29%), Positives = 27/64 (42%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLS 342 P CC + +C V CC GA+ C SSC P C + +C + P+ Sbjct: 94 PCQQACCVPVCCKPVCCVPVCC---GASSCCQQSSC----QPAC-CASSSCQQSCRVPVC 145 Query: 341 VKAL 330 KA+ Sbjct: 146 CKAV 149 Score = 28.9 bits (63), Expect = 9.0 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGA--TCCKDHSSCC 411 CC S + C V CC A TC + SSCC Sbjct: 130 CCASSSCQQSCRVPVCCKAVCCVPTCSESSSSCC 163
>KRA44_HUMAN (Q9BYR3) Keratin-associated protein 4-4 (Keratin-associated protein| 4.4) (Ultrahigh sulfur keratin-associated protein 4.4) Length = 166 Score = 30.0 bits (66), Expect = 4.0 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = -2 Query: 512 STCCCSFGFRNLCLVWGCCPAE--GATCCKD---HSSCC 411 +TCC + R C V CC + TCC+ H SCC Sbjct: 28 TTCCRTTCCRPSCCVSSCCRPQCCQTTCCRTTCCHPSCC 66
>CO7_PONPY (Q5RAD0) Complement component C7 precursor| Length = 843 Score = 30.0 bits (66), Expect = 4.0 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -2 Query: 476 CLVWGCCPAEGATC-CKDHSSCCPPDYPVC 390 C +WG C AE + C C++ S C + +C Sbjct: 776 CPLWGKCDAESSKCVCREASECEEEGFSIC 805
>CO7_HUMAN (P10643) Complement component C7 precursor| Length = 843 Score = 30.0 bits (66), Expect = 4.0 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -2 Query: 476 CLVWGCCPAEGATC-CKDHSSCCPPDYPVC 390 C +WG C AE + C C++ S C + +C Sbjct: 776 CPLWGKCDAESSKCVCREASECEEEGFSIC 805
>MT1_TETPY (O97388) Metallothionein-1 precursor (MT-1) [Contains:| Metallothionein-2 (MT-2)] Length = 107 Score = 29.6 bits (65), Expect = 5.3 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCC-PAEGATCCKDHSSCC---PPDYPVCNIRAGTCSATKN 354 CC G C CC PA+ CC D + C P C+ + C + N Sbjct: 42 CCTGTGEGCKCTGCKCCEPAKSGCCCGDKAKACCTDPNSGCCCSSKTNKCCDSTN 96
>MT1_TETPI (P80394) Metallothionein-1 precursor (MT-1) [Contains:| Metallothionein-2 (MT-2)] Length = 107 Score = 29.6 bits (65), Expect = 5.3 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCC-PAEGATCCKDHSSCC---PPDYPVCNIRAGTCSATKN 354 CC G C CC PA+ CC D + C P C+ + C + N Sbjct: 42 CCTGTGEGCKCTGCKCCQPAKSGCCCGDKAKACCTDPNSGCCCSSKTNKCCDSTN 96
>KR511_HUMAN (Q6L8G4) Keratin-associated protein 5-11 (Keratin-associated| protein 5.11) (Ultrahigh sulfur keratin-associated protein 5.11) Length = 156 Score = 29.6 bits (65), Expect = 5.3 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = -2 Query: 512 STCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNI 384 S+CC S + C CC + C SSCC P C I Sbjct: 114 SSCCQSSCCKPCCCQSSCCQSSCFKPCCCQSSCCVPVCCQCKI 156 Score = 28.9 bits (63), Expect = 9.0 Identities = 15/50 (30%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -2 Query: 515 GSTCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPD-YPVCNIRAGTC 369 GS CC S + C CC + C SSCC + C ++ C Sbjct: 98 GSFCCQSSCSKPCCCQSSCCQSSCCKPCCCQSSCCQSSCFKPCCCQSSCC 147
>KRA49_HUMAN (Q9BYQ8) Keratin-associated protein 4-9 (Keratin-associated protein| 4.9) (Ultrahigh sulfur keratin-associated protein 4.9) (Fragment) Length = 191 Score = 29.6 bits (65), Expect = 5.3 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPD--YPVCNI 384 CC S R C V CC + CC+ S CC P+ P C+I Sbjct: 100 CCISSCCRPSCCVSSCCKPQ---CCQ--SVCCQPNCCRPSCSI 137
>KR10B_HUMAN (P60412) Keratin-associated protein 10-11 (Keratin-associated| protein 10.11) (High sulfur keratin-associated protein 10.11) (Keratin-associated protein 18-11) (Keratin-associated protein 18.11) Length = 298 Score = 29.6 bits (65), Expect = 5.3 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEG--ATCCKDHSSCC 411 CC S + C V CC +TC +D SSCC Sbjct: 136 CCASSSCQPACCVPVCCKPVCCVSTCSEDSSSCC 169
>KR510_HUMAN (Q6L8G5) Keratin-associated protein 5-10 (Keratin-associated| protein 5.10) (Ultrahigh sulfur keratin-associated protein 5.10) Length = 202 Score = 29.6 bits (65), Expect = 5.3 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNI 384 CCC ++ C V CC + C SSCC P C I Sbjct: 166 CCC----QSSCCVPVCCQSSCCKPCCCQSSCCVPVCCQCKI 202 Score = 29.6 bits (65), Expect = 5.3 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPP 405 CCCS G + C C P CC+ SSCC P Sbjct: 148 CCCSSGCGSCCQSSCCNPC----CCQ--SSCCVP 175
>VWF_CANFA (Q28295) Von Willebrand factor precursor (vWF)| Length = 2813 Score = 29.6 bits (65), Expect = 5.3 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 17/87 (19%) Frame = +2 Query: 224 CRREKSSTQPHPSIPP*TPLSLDDFMPC----------FASPGC-----ASKPSRSAGCS 358 CR+++ + PS PP L+L C ++ C AS + GC+ Sbjct: 2362 CRKDECRRESPPSCPPHRTLALRKTQCCDEYECACNCVNSTVSCPLGYLASAVTNDCGCT 2421 Query: 359 WSLSKSQP*CCRRGS--PVGSSWNDPC 433 + C RG+ PVG W + C Sbjct: 2422 TTTCFPDKVCVHRGTIYPVGQFWEEAC 2448
>MTCD_TETTH (Q8WSW3) Cadmium metallothionein precursor (MT-Cd) (Cd-MT)| Length = 162 Score = 29.6 bits (65), Expect = 5.3 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Frame = -2 Query: 512 STCCCSFGFRNLCL--VWGCCPAEGATCCKDHSSCCPPDYP--VCNIRAGTCSATKNS 351 S CCC N C CC G C CC P C +A C NS Sbjct: 78 SGCCCVSKTNNCCKSDTKECCTGTGEGCKCTSCQCCKPVQQGCCCGDKAKACCTDPNS 135
>KRA47_HUMAN (Q9BYR0) Keratin-associated protein 4-7 (Keratin-associated protein| 4.7) (Ultrahigh sulfur keratin-associated protein 4.7) Length = 210 Score = 29.6 bits (65), Expect = 5.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -2 Query: 512 STCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPP 405 +TCC + +R C V CC + CC+ S CC P Sbjct: 32 TTCCRTTCYRPSCCVSSCCRPQ---CCQ--SVCCQP 62
>MT_EISFO (P81695) Cadmium-metallothionein (MT) (Fragment)| Length = 75 Score = 29.6 bits (65), Expect = 5.3 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 8/59 (13%) Frame = -2 Query: 515 GSTCCCSFGFRNLCLVWGCCPAEGATCCKD-------HSSC-CPPDYPVCNIRAGTCSA 363 GSTCCC+ CL C P CC D ++ C C C AG+C+A Sbjct: 14 GSTCCCT---NCRCLKSECLPGCKKLCCADAEKGKCGNAGCKCG---AACKCSAGSCAA 66
>LCE5A_HUMAN (Q5TCM9) Late cornified envelope protein 5A (Late envelope protein| 18) (Small proline-rich-like epidermal differentiation complex protein 5A) Length = 118 Score = 29.3 bits (64), Expect = 6.9 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 13/50 (26%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCCKDH-------------SSCC 411 P S+CC S GCC +EG CC H SSCC Sbjct: 46 PPVSSCCGSSS-------GGCCSSEGGGCCLSHHRPRQSLRRRPQSSSCC 88
>NPT2B_RAT (Q9JJ09) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 me Length = 695 Score = 29.3 bits (64), Expect = 6.9 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKD 426 CCC R C+V GC + CCK+ Sbjct: 620 CCCRVCCRVCCMVCGCKCCRCSKCCKN 646
>SCN2A_RAT (P04775) Sodium channel protein type 2 alpha subunit (Sodium| channel protein type II alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.2) (Sodium channel protein, brain II alpha subunit) Length = 2005 Score = 29.3 bits (64), Expect = 6.9 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 500 CSFGFRNLCLVWGCC 456 C + F N+CL+W CC Sbjct: 728 CWYKFANMCLIWDCC 742
>SCN2A_HUMAN (Q99250) Sodium channel protein type 2 alpha subunit (Sodium| channel protein type II alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.2) (Sodium channel protein, brain II alpha subunit) (HBSC II) Length = 2005 Score = 29.3 bits (64), Expect = 6.9 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 500 CSFGFRNLCLVWGCC 456 C + F N+CL+W CC Sbjct: 728 CWYKFANMCLIWDCC 742
>MCSP_RAT (Q64298) Sperm mitochondrial-associated cysteine-rich protein| Length = 145 Score = 29.3 bits (64), Expect = 6.9 Identities = 15/48 (31%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -2 Query: 461 CCPA-----EGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVKA 333 CCP + + CC S CCPP P C + C P + A Sbjct: 21 CCPPKPCCLQKSPCCPK-SPCCPPKSPCCTPKVCPCPTPCPCPATCPA 67
>KRA45_HUMAN (Q9BYR2) Keratin-associated protein 4-5 (Keratin-associated protein| 4.5) (Ultrahigh sulfur keratin-associated protein 4.5) Length = 186 Score = 29.3 bits (64), Expect = 6.9 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 512 STCCCSFGFRNLCLVWGCCPAE--GATCCKDHSSCCPPDYPVCNIRAGTC 369 +TCCC C V CC + + CC+ +CC P Y + + +C Sbjct: 98 TTCCCPS-----CCVSSCCRPQCCQSVCCQP--TCCRPSYCISSCCHPSC 140
>MT3_PIG (P55944) Metallothionein-3 (MT-3) (Metallothionein-III) (MT-III)| (Growth inhibitory factor) (GIF) Length = 68 Score = 29.3 bits (64), Expect = 6.9 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -2 Query: 509 TCCCSFGFRNLCLVWGCCPAEG---ATCCKDHSSCCPPDYPVC 390 TC C G C G C EG +C K SCCP + C Sbjct: 5 TCPCPTG--GSCTCAGSCKCEGCKCTSCKKSCCSCCPAECEKC 45
>MT3_BOVIN (P37359) Metallothionein-3 (MT-3) (Metallothionein-III) (MT-III)| (Growth inhibitory factor) (GIF) Length = 68 Score = 29.3 bits (64), Expect = 6.9 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCC---KDHSSCCPPDYPVC 390 P G +C CS C EG TC K SCCP + C Sbjct: 9 PTGGSCTCS----------DPCKCEGCTCASCKKSCCSCCPAECEKC 45
>MT2C_RABIT (P80290) Metallothionein-2C (MT-2C) (Metallothionein-IIC) (MT-IIC)| Length = 62 Score = 29.3 bits (64), Expect = 6.9 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -2 Query: 518 AGSTCCCSFGFRNLCLVWGC-CPAEGATCCKDHSSCCPPDYPVC 390 AG +C C+ N C C C + +CC SCCPP C Sbjct: 10 AGDSCTCA----NSCTCKACKCTSCKKSCC----SCCPPGCAKC 45
>MT2A_RABIT (P18055) Metallothionein-2A (MT-2A) (Metallothionein-IIA) (MT-IIA)| Length = 62 Score = 29.3 bits (64), Expect = 6.9 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -2 Query: 518 AGSTCCCSFGFRNLCLVWGC-CPAEGATCCKDHSSCCPPDYPVC 390 AG +C C+ N C C C + +CC SCCPP C Sbjct: 10 AGDSCTCA----NSCTCKACKCTSCKKSCC----SCCPPGCAKC 45
>KR415_HUMAN (Q9BYQ5) Keratin-associated protein 4-15 (Keratin-associated| protein 4.15) (Ultrahigh sulfur keratin-associated protein 4.15) (Fragment) Length = 193 Score = 28.9 bits (63), Expect = 9.0 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -2 Query: 512 STCCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPD--YPVCNI 384 +TCC + R C V CC + CC+ S CC P P C+I Sbjct: 60 TTCCRTTCCRPSCCVSSCCRPQ---CCQ--SVCCQPTCCRPSCSI 99
>KR10A_HUMAN (P60014) Keratin-associated protein 10-10 (Keratin-associated| protein 10.10) (High sulfur keratin-associated protein 10.10) (Keratin-associated protein 18-10) (Keratin-associated protein 18.10) Length = 251 Score = 28.9 bits (63), Expect = 9.0 Identities = 15/54 (27%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = -2 Query: 518 AGSTCCCSFGFRNLCLVWGCCPAEGATCCKDH----SSCCPPDYPVCNIRAGTC 369 A ++CC + C CC + H S+CC P P C A +C Sbjct: 164 ASTSCCQQSSCQPACCTASCCRPSSSVSLLCHPVCKSTCCVP-VPSCGASASSC 216
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 28.9 bits (63), Expect = 9.0 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGA--TCCKDHSSCCPP 405 CC S + C V CC TC D SCC P Sbjct: 218 CCTSSPCQQACCVPVCCKPVCCVPTCSDDSGSCCQP 253
>CRIM1_BRARE (Q7T3Q2) Cysteine-rich motor neuron 1 protein precursor (CRIM-1)| Length = 1027 Score = 28.9 bits (63), Expect = 9.0 Identities = 29/100 (29%), Positives = 35/100 (35%), Gaps = 2/100 (2%) Frame = -2 Query: 506 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCP--PDYPVCNIRAGTCSATKNSPLSVKA 333 C C G R LC C P + + SCCP PD PV T N + Sbjct: 696 CTCHSG-RVLCETEVCPPLLCHSPIRTQDSCCPHCPDDPV------TPQTPSNDSMPSYC 748 Query: 332 LKRTLAMRNTA*SRRGKAVSKVE*KDAAVWSFSPSCTPTN 213 + A S + S D A+ FS SC P N Sbjct: 749 RNEDGDIFLAAESWKPNVCSSCVCLDGAISCFSESCPPVN 788
>LCE2C_HUMAN (Q5TA81) Late cornified envelope protein 2C (Late envelope protein| 11) Length = 110 Score = 28.9 bits (63), Expect = 9.0 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -2 Query: 461 CCPAEGATCCKDHSSCC-PPDYPVCNIRAGTCSATKNSP 348 C PA + C SCC P C+ AG CS + + P Sbjct: 40 CFPAVSSCCGPSSGSCCGPSSGGCCSSGAGGCSLSHHRP 78
>MT3_HORSE (P37360) Metallothionein-3 (MT-3) (Metallothionein-III) (MT-III)| (Growth inhibitory factor) (GIF) Length = 68 Score = 28.9 bits (63), Expect = 9.0 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = -2 Query: 521 PAGSTCCCSFGFRNLCLVWGCCPAEGATCC---KDHSSCCPPDYPVC 390 P G +C CS G C EG C K SCCP + C Sbjct: 9 PTGGSCTCS----------GECKCEGCKCTSCKKSCCSCCPAECEKC 45 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,002,562 Number of Sequences: 219361 Number of extensions: 1483374 Number of successful extensions: 4628 Number of sequences better than 10.0: 68 Number of HSP's better than 10.0 without gapping: 4018 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4507 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3985467738 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)