| Clone Name | rbart45a04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZN133_HUMAN (P52736) Zinc finger protein 133 | 30 | 3.2 | 2 | RL26_LITLI (Q95WA0) 60S ribosomal protein L26 | 30 | 5.5 | 3 | YGCF_SHIFL (P64556) Hypothetical protein ygcF | 29 | 7.2 | 4 | YGCF_ECOLI (P64554) Hypothetical protein ygcF | 29 | 7.2 | 5 | YGCF_ECO57 (P64555) Hypothetical protein ygcF | 29 | 7.2 | 6 | RPH1_YEAST (P39956) DNA damage-responsive transcriptional repres... | 29 | 9.3 | 7 | GIS1_YEAST (Q03833) Transcriptional activator/repressor GIS1 | 29 | 9.3 | 8 | FREM1_MOUSE (Q684R7) FRAS1-related extracellular matrix protein ... | 29 | 9.3 |
|---|
>ZN133_HUMAN (P52736) Zinc finger protein 133| Length = 654 Score = 30.4 bits (67), Expect = 3.2 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 9/54 (16%) Frame = -2 Query: 286 CMHQFSLPPTSLISGKHTHAGHSPWE--------GIKSMLGRFQ-WHGGEPPVL 152 C H FS T LIS + TH G P+ +KS L R Q H GE P++ Sbjct: 415 CGHSFSQNST-LISHRRTHTGEKPYVCGVCGRGFSLKSHLNRHQNIHSGEKPIV 467
>RL26_LITLI (Q95WA0) 60S ribosomal protein L26| Length = 144 Score = 29.6 bits (65), Expect = 5.5 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = -1 Query: 335 KRFKAADHAPAHANKKVYASIFTSSNKSDFRETYSCRSLPLGRN 204 K K +AP+H +K I +S + R+ Y+CRS+P+ ++ Sbjct: 13 KNRKRHFNAPSHMRRK----IMSSPMSKELRQKYNCRSMPIRKD 52
>YGCF_SHIFL (P64556) Hypothetical protein ygcF| Length = 223 Score = 29.3 bits (64), Expect = 7.2 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 105 ILELMGKPWYEANR*ISTGGSPPCHWNLPNIDLIPSQG 218 +L ++G+ Y A + TGG P H LP DL+ G Sbjct: 75 LLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNG 112
>YGCF_ECOLI (P64554) Hypothetical protein ygcF| Length = 223 Score = 29.3 bits (64), Expect = 7.2 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 105 ILELMGKPWYEANR*ISTGGSPPCHWNLPNIDLIPSQG 218 +L ++G+ Y A + TGG P H LP DL+ G Sbjct: 75 LLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNG 112
>YGCF_ECO57 (P64555) Hypothetical protein ygcF| Length = 223 Score = 29.3 bits (64), Expect = 7.2 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 105 ILELMGKPWYEANR*ISTGGSPPCHWNLPNIDLIPSQG 218 +L ++G+ Y A + TGG P H LP DL+ G Sbjct: 75 LLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNG 112
>RPH1_YEAST (P39956) DNA damage-responsive transcriptional repressor RPH1| Length = 796 Score = 28.9 bits (63), Expect = 9.3 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -1 Query: 377 EKLENGKKGEAAP--AKRFKAADHAPAHANKKV 285 + + +G+K + P KRFK DH H NKK+ Sbjct: 729 KSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKI 761
>GIS1_YEAST (Q03833) Transcriptional activator/repressor GIS1| Length = 894 Score = 28.9 bits (63), Expect = 9.3 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -1 Query: 377 EKLENGKKGEAAP--AKRFKAADHAPAHANKKV 285 + + +G+K + P KRFK DH H NKK+ Sbjct: 848 KSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKKI 880
>FREM1_MOUSE (Q684R7) FRAS1-related extracellular matrix protein 1 precursor| (QBRICK protein) Length = 2191 Score = 28.9 bits (63), Expect = 9.3 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 8/53 (15%) Frame = -2 Query: 295 TRKCMHQFSLPPTSLISGKHTH-----AGHSP-WEGIKSM--LGRFQWHGGEP 161 TR C Q +++S +H +G P W G+K+ G ++W GGEP Sbjct: 2091 TRACREQHQGDLVTVLSRRHMQWLWAMSGRKPFWIGLKNQPRTGHWEWIGGEP 2143 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,874,289 Number of Sequences: 219361 Number of extensions: 1231237 Number of successful extensions: 3097 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2981 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3093 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4142954952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)