| Clone Name | rbart44d02 |
|---|---|
| Clone Library Name | barley_pub |
>ORYB_ORYSA (P25777) Oryzain beta chain precursor (EC 3.4.22.-)| Length = 471 Score = 146 bits (368), Expect = 3e-35 Identities = 61/68 (89%), Positives = 64/68 (94%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVKALK 301 CCC+FGFRNLCLVWGCCP EGATCCKDH+SCCPPDYPVCN RAGTCSA+KNSPLSVKALK Sbjct: 397 CCCAFGFRNLCLVWGCCPVEGATCCKDHASCCPPDYPVCNTRAGTCSASKNSPLSVKALK 456 Query: 300 RTLAMRNT 277 RTLA NT Sbjct: 457 RTLAKLNT 464
>CYSPL_LYCES (P20721) Low-temperature-induced cysteine proteinase precursor (EC| 3.4.22.-) (Fragment) Length = 346 Score = 112 bits (279), Expect = 7e-25 Identities = 47/78 (60%), Positives = 53/78 (67%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVKALK 301 CCC FR C WGCCP EGATCC+DH SCCP DYP+CN+R GTCS +K +PL VKA+K Sbjct: 268 CCCILQFRRSCFSWGCCPLEGATCCEDHYSCCPHDYPICNVRQGTCSMSKGNPLGVKAMK 327 Query: 300 RTLAMRNTA*SRRGKAVS 247 R LA A GK S Sbjct: 328 RILAQPIGAFGNGGKKSS 345
>CYSP1_ORYSA (Q7XR52) Cysteine protease 1 precursor (EC 3.4.22.-) (OsCP1)| Length = 490 Score = 108 bits (271), Expect = 6e-24 Identities = 39/57 (68%), Positives = 49/57 (85%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVK 310 CCC++G RN C+VWGCCP EGATCCKDHS+CCP +YPVCN +A TCS +KNSP +++ Sbjct: 407 CCCNYGIRNHCIVWGCCPVEGATCCKDHSTCCPKEYPVCNAKARTCSKSKNSPYNIR 463
>ORYA_ORYSA (P25776) Oryzain alpha chain precursor (EC 3.4.22.-)| Length = 458 Score = 108 bits (270), Expect = 7e-24 Identities = 42/67 (62%), Positives = 50/67 (74%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVKALK 301 CCC + + C WGCCP EGATCC DH SCCP +YP+CN++ GTC K+SPL+VKALK Sbjct: 379 CCCIYEYGKYCYAWGCCPLEGATCCDDHYSCCPHEYPICNVQQGTCLMAKDSPLAVKALK 438 Query: 300 RTLAMRN 280 RTLA N Sbjct: 439 RTLAKPN 445
>RD21A_ARATH (P43297) Cysteine proteinase RD21a precursor (EC 3.4.22.-) (RD21)| Length = 462 Score = 97.8 bits (242), Expect = 1e-20 Identities = 38/61 (62%), Positives = 44/61 (72%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVKALK 301 CCC F + C WGCCP E ATCC D+ SCCP +YPVC++ GTC +KNSP SVKALK Sbjct: 387 CCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKALK 446 Query: 300 R 298 R Sbjct: 447 R 447
>GRN_HUMAN (P28799) Granulins precursor (Proepithelin) (PEPI) [Contains:| Acrogranin; Paragranulin; Granulin-1 (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Granulin B); Granulin-4 (Granulin A); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granul Length = 593 Score = 48.5 bits (114), Expect = 9e-06 Identities = 17/33 (51%), Positives = 21/33 (63%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 343 WGCCP A CC+DH CCP + C+ + GTC Sbjct: 304 WGCCPFTQAVCCEDHIHCCPAGF-TCDTQKGTC 335 Score = 47.8 bits (112), Expect = 2e-05 Identities = 18/39 (46%), Positives = 24/39 (61%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNS 325 +GCCP ATCC DH CCP D VC++ C + +N+ Sbjct: 229 YGCCPMPNATCCSDHLHCCPQD-TVCDLIQSKCLSKENA 266 Score = 45.8 bits (107), Expect = 6e-05 Identities = 19/46 (41%), Positives = 23/46 (50%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 343 CC S G W CC A CC+D CCP Y CN++A +C Sbjct: 456 CCPSLGGS-----WACCQLPHAVCCEDRQHCCPAGY-TCNVKARSC 495 Score = 44.3 bits (103), Expect = 2e-04 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDY 373 WGCCP A CC DH CCP Y Sbjct: 386 WGCCPIPEAVCCSDHQHCCPQGY 408 Score = 39.7 bits (91), Expect = 0.004 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC-SATKNSPLSVK 310 WGCCP A+CC+D CCP C++ C + T PL+ K Sbjct: 147 WGCCPMPQASCCEDRVHCCPHG-AFCDLVHTRCITPTGTHPLAKK 190 Score = 37.7 bits (86), Expect = 0.016 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATK----NSPLSVKALKRTL 292 W CCP CC D CCP + C R C + ++PL AL++ L Sbjct: 541 WACCPYRQGVCCADRRHCCPAGFR-CAARGTKCLRREAPRWDAPLRDPALRQLL 593 Score = 28.9 bits (63), Expect = 7.5 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = -3 Query: 474 CSFGFRNLCLVWG---CCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 343 CS G + V G CCP A C D CCP + C+ +C Sbjct: 67 CSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFH-CSADGRSC 112
>GRN_MOUSE (P28798) Granulins precursor (Proepithelin) (PEPI) (PC cell-derived| growth factor) (PCDGF) [Contains: Acrogranin; Granulin-1; Granulin-2; Granulin-3; Granulin-4; Granulin-5; Granulin-6; Granulin-7] Length = 589 Score = 48.1 bits (113), Expect = 1e-05 Identities = 21/51 (41%), Positives = 28/51 (54%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVKALKRTLA 289 WGCCP A CC+DH CCP + C+ GTC + L V +K+ +A Sbjct: 302 WGCCPFAKAVCCEDHIHCCPAGFQ-CHTEKGTC---EMGILQVPWMKKVIA 348 Score = 45.4 bits (106), Expect = 8e-05 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 343 W CC A CC+D CCP Y CN++A TC Sbjct: 462 WACCQLPHAVCCEDRQHCCPAGY-TCNVKARTC 493 Score = 43.1 bits (100), Expect = 4e-04 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 343 +GCCP A CC DH CCP D VC++ C Sbjct: 228 YGCCPMPNAICCSDHLHCCPQD-TVCDLIQSKC 259 Score = 40.0 bits (92), Expect = 0.003 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDY 373 WGCCP A CC D+ CCP + Sbjct: 384 WGCCPIPEAVCCSDNQHCCPQGF 406 Score = 39.3 bits (90), Expect = 0.006 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCP 382 WGCCP A+CC+D CCP Sbjct: 146 WGCCPMPQASCCEDRVHCCP 165 Score = 38.1 bits (87), Expect = 0.012 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -3 Query: 444 VWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATK 331 VW CCP CC+D CCP + C+ R C K Sbjct: 536 VWACCPYLKGVCCRDGRHCCPGGFH-CSARGTKCLRKK 572 Score = 31.6 bits (70), Expect = 1.2 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Frame = -3 Query: 474 CSFGFRNLCLVWG---CCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPL 319 C G+ L V G CCP C D CCP + C+ +C ++PL Sbjct: 67 CPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFH-CSADGKSCFQMSDNPL 120
>GRN_RAT (P23785) Granulins precursor [Contains: Acrogranin; Granulin-1| (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Granulin B) (Epithelin-2); Granulin-4 (Granulin A) (Epithelin-1); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granulin-7 (Gran Length = 588 Score = 48.1 bits (113), Expect = 1e-05 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 343 WGCCP A CC+DH CCP + C+ GTC Sbjct: 301 WGCCPFTKAVCCEDHIHCCPAGFQ-CHTETGTC 332 Score = 45.8 bits (107), Expect = 6e-05 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNS 325 W CC A CC+D CCP Y CN++A TC S Sbjct: 461 WACCQLPHAVCCEDRQHCCPAGY-TCNVKARTCEKDAGS 498 Score = 43.1 bits (100), Expect = 4e-04 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 343 +GCCP A CC DH CCP D VC++ C Sbjct: 227 YGCCPMPNAICCSDHLHCCPQD-TVCDLIQSKC 258 Score = 42.0 bits (97), Expect = 9e-04 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDY 373 WGCCP A CC DH CCP + Sbjct: 383 WGCCPMPEAVCCLDHQHCCPQGF 405 Score = 40.4 bits (93), Expect = 0.002 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVK 310 WGCCP A+CC+D CCP + S T PL K Sbjct: 146 WGCCPMPQASCCEDRVHCCPHGASCDLVHTRCISPTGTHPLLKK 189 Score = 35.4 bits (80), Expect = 0.080 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATK 331 W CCP CC+D CCP + C+ + C K Sbjct: 536 WACCPYVKGVCCRDGRHCCPIGFH-CSAKGTKCLRKK 571 Score = 31.6 bits (70), Expect = 1.2 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Frame = -3 Query: 474 CSFGFRNLCLVWG---CCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPL 319 C G+ L V G CCP C D CCP + C+ +CS +S L Sbjct: 67 CPDGYSCLLTVSGTSSCCPFSEGVSCDDGQHCCPRGFH-CSADGKSCSQISDSLL 120
>GRN_CAVPO (P28797) Granulins precursor (Proepithelin) (PEPI) [Contains:| Acrogranin; Granulin-1; Granulin-2; Granulin-3; Granulin-4; Granulin-5; Granulin-6; Granulin-7] (Fragment) Length = 591 Score = 46.2 bits (108), Expect = 5e-05 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 343 +GCCP A CC DH CCP D VC++R C Sbjct: 229 YGCCPMPNAICCSDHLHCCPQD-TVCDLRQSRC 260 Score = 44.3 bits (103), Expect = 2e-04 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 343 WGCCP A CC+DH CCP + C+ TC Sbjct: 303 WGCCPFPKAVCCEDHVHCCPERFR-CHTEKDTC 334 Score = 43.1 bits (100), Expect = 4e-04 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 343 W CC A CC+D CCP Y CN++A +C Sbjct: 461 WACCQLPHAVCCEDGQHCCPAGY-TCNVKARSC 492 Score = 40.8 bits (94), Expect = 0.002 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVK 310 WGCCP A+CC+D CCP + +A + PL+ K Sbjct: 133 WGCCPMPQASCCEDRVHCCPHGASCDLVHIRCVTALGSHPLTTK 176 Score = 39.7 bits (91), Expect = 0.004 Identities = 21/53 (39%), Positives = 24/53 (45%) Frame = -3 Query: 441 WGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVKALKRTLAMR 283 W CCP CCKD CCP + C + GT K S L +L R A R Sbjct: 538 WACCPFHQGVCCKDQRHCCPAGFH-CESQ-GTRCVHKKSLLHWDSLPRPAAPR 588 Score = 31.6 bits (70), Expect = 1.2 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 435 CCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 343 CCP A C D CCP + C+ GTC Sbjct: 69 CCPFSQAMACGDGHHCCPYGFH-CSTDGGTC 98
>KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-associated protein| 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 34.7 bits (78), Expect = 0.14 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCC--PAEGATCCK---DHSSCCPP 379 CCCS G + C CC ++CCK SSCC P Sbjct: 135 CCCSSGCGSSCCQSSCCKPSCSQSSCCKPCCSQSSCCKP 173 Score = 33.9 bits (76), Expect = 0.23 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNI 358 CCCS G + C CC C SSCC P C I Sbjct: 203 CCCSSGCGSSCCQSSCCKP-----CSSQSSCCVPICCQCKI 238 Score = 32.7 bits (73), Expect = 0.52 Identities = 18/55 (32%), Positives = 22/55 (40%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLS 316 CCCS G + C CC CC SSCC P + C ++ P S Sbjct: 174 CCCSSGCGSSCCQSSCC----KPCC-SQSSCCKPCCCSSGCGSSCCQSSCCKPCS 223 Score = 29.6 bits (65), Expect = 4.4 Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 6/51 (11%) Frame = +3 Query: 276 PCFASPGCASKPSRSAGCSWSLSKS---QP*CCRRG---SPVGSSWNDPCS 410 PC S GC S +S+ C S+S +P CC G S SS PCS Sbjct: 173 PCCCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPCS 223
>CVP5_PIMHY (Q8T0W1) Cysteine-rich venom protein 5 precursor| Length = 115 Score = 34.3 bits (77), Expect = 0.18 Identities = 25/89 (28%), Positives = 37/89 (41%) Frame = -3 Query: 432 CPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVKALKRTLAMRNTA*SRRGKA 253 C + GA+C ++CC VCN+ C A P++ + +RT R T RG Sbjct: 26 CSSMGASCQIGSATCCG----VCNVHTLRCEARIGPPINTQPTRRTQPTRRT----RGPK 77 Query: 252 VSKVE*KDAAVWSFSPSCTPTNLCSKFKP 166 V++ S PTN + KP Sbjct: 78 VTR-------------SSRPTNRTRRPKP 93
>MCSP_HUMAN (P49901) Sperm mitochondrial-associated cysteine-rich protein| Length = 116 Score = 33.5 bits (75), Expect = 0.30 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 4/47 (8%) Frame = -3 Query: 435 CCPAEGATCC-KDHSSCCPPDYPVCNIRAGTC---SATKNSPLSVKA 307 CC +G+ CC H+ CC P P C I+A C + + SPL++++ Sbjct: 42 CCQPKGSQCCPPKHNHCCQPKPPCC-IQARCCGLETKPEVSPLNMES 87 Score = 30.0 bits (66), Expect = 3.3 Identities = 14/47 (29%), Positives = 19/47 (40%), Gaps = 10/47 (21%) Frame = -3 Query: 435 CCPAEGATCCKDH---------SSCCPP-DYPVCNIRAGTCSATKNS 325 CCPA+G CC + CCPP C + C K++ Sbjct: 10 CCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHN 56
>KRA54_HUMAN (Q6L8H1) Keratin-associated protein 5-4 (Keratin-associated protein| 5.4) (Ultrahigh sulfur keratin-associated protein 5.4) Length = 288 Score = 33.5 bits (75), Expect = 0.30 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 6/40 (15%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCC------PAEGATCCKDHSSCCPP 379 CCCS G + C CC G++CC+ SSCC P Sbjct: 205 CCCSSGCGSSCCQSSCCKPCCSSSGCGSSCCQ--SSCCKP 242 Score = 28.9 bits (63), Expect = 7.5 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNI 358 CC S G + C CC CC SSCC P C I Sbjct: 253 CCSSSGCGSSCCQSSCCNP----CCSQ-SSCCVPVCCQCKI 288
>KRA51_HUMAN (Q6L8H4) Keratin-associated protein 5-1 (Keratin-associated protein| 5.1) (Ultrahigh sulfur keratin-associated protein 5.1) Length = 278 Score = 33.1 bits (74), Expect = 0.40 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNI 358 CCCS G + C CC CC SSCC P C I Sbjct: 243 CCCSSGCGSSCCQSSCCKP----CCSQ-SSCCVPVCCQCKI 278
>KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-associated protein| 5.8) (Ultrahigh sulfur keratin-associated protein 5.8) (Keratin, ultra high-sulfur matrix protein B) (UHS keratin B) (UHS KerB) Length = 187 Score = 33.1 bits (74), Expect = 0.40 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNI 358 CCCS G + C CC CC SSCC P C I Sbjct: 152 CCCSSGCGSSCCQSSCCKP----CCSQ-SSCCVPICCQCKI 187 Score = 32.7 bits (73), Expect = 0.52 Identities = 18/48 (37%), Positives = 22/48 (45%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSA 337 CCCS G + C CC CC SSCC P C+ +G S+ Sbjct: 94 CCCSSGCGSSCCQSSCC----KPCC-SQSSCCKP----CSCSSGCGSS 132 Score = 28.5 bits (62), Expect = 9.7 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPP 379 C CS G + C CC CC SSCC P Sbjct: 123 CSCSSGCGSSCCQSSCCKP----CCSQ-SSCCKP 151
>GRN1_CYPCA (P81013) Granulin-1| Length = 57 Score = 32.7 bits (73), Expect = 0.52 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -3 Query: 480 CCCS-FGFRNLCLVWGCCPAEGATCCKDHSSCCPPDY 373 CC S +G VW CCP CC+D CC Y Sbjct: 16 CCLSPYG------VWYCCPFSMGQCCRDGIHCCRHGY 46
>KRA57_HUMAN (Q6L8G8) Keratin-associated protein 5-7 (Keratin-associated protein| 5.7) (Ultrahigh sulfur keratin-associated protein 5.7) (Keratin-associated protein 5-3) (Keratin-associated protein 5.3) Length = 165 Score = 32.7 bits (73), Expect = 0.52 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNI 358 CCCS G + C CC CC SSCC P C I Sbjct: 130 CCCSSGCGSSCCQSSCCNP----CCSQ-SSCCVPVCCQCKI 165 Score = 32.3 bits (72), Expect = 0.67 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPP 379 CCCS G + C CC CC+ SSCC P Sbjct: 101 CCCSSGCGSSCCQSSCCK---PCCCQ--SSCCKP 129
>GRN3_CYPCA (P81015) Granulin-3| Length = 57 Score = 32.3 bits (72), Expect = 0.67 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -3 Query: 477 CCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDY 373 CC F VW CCP CC+D CC Y Sbjct: 16 CCRSPFG----VWYCCPFLMGQCCRDGRHCCRHGY 46
>GRN2_CYPCA (P81014) Granulin-2| Length = 57 Score = 32.3 bits (72), Expect = 0.67 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -3 Query: 477 CCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDY 373 CC F VW CCP CC+D CC Y Sbjct: 16 CCRSPFG----VWYCCPFLMGQCCRDGRHCCRHGY 46
>YDB4_SCHPO (Q10357) Hypothetical protein C22E12.04 in chromosome I| Length = 297 Score = 32.0 bits (71), Expect = 0.88 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -3 Query: 477 CCSFGFRNLCLVW--GCCPAEGATCC-KDHSSCCPPDYPVC 364 CCS + C GCC E +CC ++ SCC + P C Sbjct: 247 CCSSKKPSCCSQEKKGCCSTEKTSCCSQEKKSCCTSEKPSC 287
>KRA55_HUMAN (Q701N2) Keratin-associated protein 5-5 (Keratin-associated protein| 5.5) (Ultrahigh sulfur keratin-associated protein 5.5) (Keratin-associated protein 5-11) (Keratin-associated protein 5.11) Length = 221 Score = 32.0 bits (71), Expect = 0.88 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPP 379 CCCS G + C CC CC+ SSCC P Sbjct: 157 CCCSSGCGSSCCQSSCCK---PYCCQ--SSCCKP 185
>KRA52_HUMAN (Q701N4) Keratin-associated protein 5-2 (Keratin-associated protein| 5.2) (Ultrahigh sulfur keratin-associated protein 5.2) (Keratin-associated protein 5-8) (Keratin-associated protein 5.8) Length = 177 Score = 32.0 bits (71), Expect = 0.88 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPP 379 CCCS G + C CC CC+ SSCC P Sbjct: 122 CCCSSGCGSSCCQSSCCK---PCCCQ--SSCCVP 150 Score = 28.5 bits (62), Expect = 9.7 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNI 358 CCC ++ C V CC + C S+CC P C I Sbjct: 141 CCC----QSSCCVPVCCQSSCCKPCCCQSNCCVPVCCQCKI 177
>KR171_HUMAN (Q9BYP8) Keratin-associated protein 17-1 (Keratin associated| protein 16.1) Length = 105 Score = 32.0 bits (71), Expect = 0.88 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 Query: 438 GCCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 343 GCCP + TCC +CC C + G C Sbjct: 2 GCCPGDCFTCCTQEQNCCEE----CCCQPGCC 29
>PMD1_LOCMI (P80059) Pars intercerebralis major peptide D1 (PMP-D1)| Length = 54 Score = 31.6 bits (70), Expect = 1.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -3 Query: 438 GCCPAEGATCCKDHSSCCP 382 GCCP + CC D CCP Sbjct: 22 GCCPYKEGVCCLDGIHCCP 40
>KRA59_HUMAN (P26371) Keratin-associated protein 5-9 (Keratin-associated protein| 5.9) (Ultrahigh sulfur keratin-associated protein 5.9) (Keratin, cuticle, ultrahigh sulfur 1) (Keratin, ultra high-sulfur matrix protein A) (UHS keratin A) (UHS KerA) Length = 169 Score = 31.6 bits (70), Expect = 1.2 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 16/50 (32%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCC----------------PAEGATCCKDHSSCCPP 379 CCCS G + C CC G++CC+ SSCC P Sbjct: 86 CCCSSGCGSSCCQCSCCKPYCSQCSCCKPCCSSSGRGSSCCQ--SSCCKP 133
>MCSP_MOUSE (P15265) Sperm mitochondrial-associated cysteine-rich protein| Length = 143 Score = 31.2 bits (69), Expect = 1.5 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 435 CCPAEGATCCKDHSSCCPPDYPVCNIRAGTCSATKN 328 CCP + +CC +CCP P C TC +++N Sbjct: 74 CCPQK-CSCCPKKCTCCPQPPPCC--AQPTCCSSEN 106 Score = 30.4 bits (67), Expect = 2.6 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 435 CCPAEGATCCKDHSSCCPPDYPVCNIRAGTC 343 CCP + C K S CCPP P C + C Sbjct: 26 CCPQKPPCCPK--SPCCPPKSPCCPPKPCPC 54
>KR105_HUMAN (P60370) Keratin-associated protein 10-5 (Keratin-associated| protein 10.5) (High sulfur keratin-associated protein 10.5) (Keratin-associated protein 18-5) (Keratin-associated protein 18.5) Length = 271 Score = 30.8 bits (68), Expect = 2.0 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGA--TCCKDHSSCC 385 CC S + C V CC TC KD SSCC Sbjct: 78 CCASSPCQQACCVPVCCKPVCCLPTCSKDSSSCC 111 Score = 29.6 bits (65), Expect = 4.4 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGA--TCCKDHSSCC 385 CC S + C V CC TC +D SSCC Sbjct: 120 CCASSSCQQSCCVPVCCKPVCCVPTCSEDSSSCC 153
>LCE3B_HUMAN (Q5TA77) Late cornified envelope protein 3B (Late envelope protein| 14) Length = 95 Score = 30.4 bits (67), Expect = 2.6 Identities = 20/64 (31%), Positives = 25/64 (39%), Gaps = 7/64 (10%) Frame = +3 Query: 198 CRREKSSTQPHPSIPP*T--PLSLDDFMP-----CFASPGCASKPSRSAGCSWSLSKSQP 356 C++ + QP P P P S +P C PGC PS GC S + Sbjct: 3 CQQNQQQCQPLPKCPSPKCPPKSSAQCLPPASSCCAPRPGCCGGPSSEGGCCLSHHR--- 59 Query: 357 *CCR 368 CCR Sbjct: 60 -CCR 62
>ENA1_HORSE (P80930) Antimicrobial peptide eNAP-1 (Fragment)| Length = 46 Score = 30.4 bits (67), Expect = 2.6 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -3 Query: 435 CCPAEGATCCKDHSSCCP 382 CCP CC D CCP Sbjct: 26 CCPYSQGVCCADQRHCCP 43
>HUTU_STRCO (Q9KZ75) Urocanate hydratase (EC 4.2.1.49) (Urocanase)| (Imidazolonepropionate hydrolase) Length = 572 Score = 30.4 bits (67), Expect = 2.6 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 316 REGFEAHPGDAKHGMKSSRE 257 REG EAH GDA HG ++RE Sbjct: 549 REGDEAHEGDAAHGSGAARE 568
>KRA48_HUMAN (Q9BYQ9) Keratin-associated protein 4-8 (Keratin-associated protein| 4.8) (Ultrahigh sulfur keratin-associated protein 4.8) (Fragment) Length = 114 Score = 30.4 bits (67), Expect = 2.6 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPD--YPVCNI 358 CC S R C V CC + CC+ S CC P +P C+I Sbjct: 23 CCISSCCRPSCCVSSCCKPQ---CCQ--SVCCQPTCCHPSCSI 60
>KR414_HUMAN (Q9BYQ6) Keratin-associated protein 4-14 (Keratin-associated| protein 4.14) (Ultrahigh sulfur keratin-associated protein 4.14) Length = 195 Score = 30.0 bits (66), Expect = 3.3 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPD--YPVCNI 358 CC S R C V CC + CC+ S CC P +P C+I Sbjct: 104 CCISSCCRPSCCVSSCCRPQ---CCQ--SVCCQPTCCHPSCSI 141 Score = 28.5 bits (62), Expect = 9.7 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 10/44 (22%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAE-------GATCCKDH---SSCCPP 379 CC S R C V CC + TCC+ SSCC P Sbjct: 69 CCISSCCRPSCCVSSCCKPQCCQSMCCQPTCCRPRCCISSCCRP 112
>NPT2B_MOUSE (Q9DBP0) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 697 Score = 30.0 bits (66), Expect = 3.3 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKD 400 CCC R C+V GC + CC+D Sbjct: 620 CCCRVCCRVCCMVCGCKCCRCSKCCRD 646
>CO7_PONPY (Q5RAD0) Complement component C7 precursor| Length = 843 Score = 30.0 bits (66), Expect = 3.3 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -3 Query: 450 CLVWGCCPAEGATC-CKDHSSCCPPDYPVC 364 C +WG C AE + C C++ S C + +C Sbjct: 776 CPLWGKCDAESSKCVCREASECEEEGFSIC 805
>CO7_HUMAN (P10643) Complement component C7 precursor| Length = 843 Score = 30.0 bits (66), Expect = 3.3 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -3 Query: 450 CLVWGCCPAEGATC-CKDHSSCCPPDYPVC 364 C +WG C AE + C C++ S C + +C Sbjct: 776 CPLWGKCDAESSKCVCREASECEEEGFSIC 805
>KR10B_HUMAN (P60412) Keratin-associated protein 10-11 (Keratin-associated| protein 10.11) (High sulfur keratin-associated protein 10.11) (Keratin-associated protein 18-11) (Keratin-associated protein 18.11) Length = 298 Score = 29.6 bits (65), Expect = 4.4 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEG--ATCCKDHSSCC 385 CC S + C V CC +TC +D SSCC Sbjct: 136 CCASSSCQPACCVPVCCKPVCCVSTCSEDSSSCC 169
>MT1_TETPY (O97388) Metallothionein-1 precursor (MT-1) [Contains:| Metallothionein-2 (MT-2)] Length = 107 Score = 29.6 bits (65), Expect = 4.4 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCC-PAEGATCCKDHSSCC---PPDYPVCNIRAGTCSATKN 328 CC G C CC PA+ CC D + C P C+ + C + N Sbjct: 42 CCTGTGEGCKCTGCKCCEPAKSGCCCGDKAKACCTDPNSGCCCSSKTNKCCDSTN 96
>MT1_TETPI (P80394) Metallothionein-1 precursor (MT-1) [Contains:| Metallothionein-2 (MT-2)] Length = 107 Score = 29.6 bits (65), Expect = 4.4 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCC-PAEGATCCKDHSSCC---PPDYPVCNIRAGTCSATKN 328 CC G C CC PA+ CC D + C P C+ + C + N Sbjct: 42 CCTGTGEGCKCTGCKCCQPAKSGCCCGDKAKACCTDPNSGCCCSSKTNKCCDSTN 96
>KRA49_HUMAN (Q9BYQ8) Keratin-associated protein 4-9 (Keratin-associated protein| 4.9) (Ultrahigh sulfur keratin-associated protein 4.9) (Fragment) Length = 191 Score = 29.6 bits (65), Expect = 4.4 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPD--YPVCNI 358 CC S R C V CC + CC+ S CC P+ P C+I Sbjct: 100 CCISSCCRPSCCVSSCCKPQ---CCQ--SVCCQPNCCRPSCSI 137
>KR510_HUMAN (Q6L8G5) Keratin-associated protein 5-10 (Keratin-associated| protein 5.10) (Ultrahigh sulfur keratin-associated protein 5.10) Length = 202 Score = 29.6 bits (65), Expect = 4.4 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPPDYPVCNI 358 CCC ++ C V CC + C SSCC P C I Sbjct: 166 CCC----QSSCCVPVCCQSSCCKPCCCQSSCCVPVCCQCKI 202 Score = 29.6 bits (65), Expect = 4.4 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCPP 379 CCCS G + C C P CC+ SSCC P Sbjct: 148 CCCSSGCGSCCQSSCCNPC----CCQ--SSCCVP 175
>VWF_CANFA (Q28295) Von Willebrand factor precursor (vWF)| Length = 2813 Score = 29.6 bits (65), Expect = 4.4 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 17/87 (19%) Frame = +3 Query: 198 CRREKSSTQPHPSIPP*TPLSLDDFMPC----------FASPGC-----ASKPSRSAGCS 332 CR+++ + PS PP L+L C ++ C AS + GC+ Sbjct: 2362 CRKDECRRESPPSCPPHRTLALRKTQCCDEYECACNCVNSTVSCPLGYLASAVTNDCGCT 2421 Query: 333 WSLSKSQP*CCRRGS--PVGSSWNDPC 407 + C RG+ PVG W + C Sbjct: 2422 TTTCFPDKVCVHRGTIYPVGQFWEEAC 2448
>KR101_HUMAN (P60331) Keratin-associated protein 10-1 (Keratin-associated| protein 10.1) (High sulfur keratin-associated protein 10.1) (Keratin-associated protein 18-1) (Keratin-associated protein 18.1) Length = 282 Score = 29.3 bits (64), Expect = 5.7 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGA--TCCKDHSSCC 385 CC S + C + CC TC KD SSCC Sbjct: 89 CCTSSPCQQACCMPVCCKPVCCLPTCSKDSSSCC 122
>SCN2A_RAT (P04775) Sodium channel protein type 2 alpha subunit (Sodium| channel protein type II alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.2) (Sodium channel protein, brain II alpha subunit) Length = 2005 Score = 29.3 bits (64), Expect = 5.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 474 CSFGFRNLCLVWGCC 430 C + F N+CL+W CC Sbjct: 728 CWYKFANMCLIWDCC 742
>SCN2A_HUMAN (Q99250) Sodium channel protein type 2 alpha subunit (Sodium| channel protein type II alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.2) (Sodium channel protein, brain II alpha subunit) (HBSC II) Length = 2005 Score = 29.3 bits (64), Expect = 5.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 474 CSFGFRNLCLVWGCC 430 C + F N+CL+W CC Sbjct: 728 CWYKFANMCLIWDCC 742
>NPT2B_RAT (Q9JJ09) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 me Length = 695 Score = 29.3 bits (64), Expect = 5.7 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKD 400 CCC R C+V GC + CCK+ Sbjct: 620 CCCRVCCRVCCMVCGCKCCRCSKCCKN 646
>MCSP_RAT (Q64298) Sperm mitochondrial-associated cysteine-rich protein| Length = 145 Score = 29.3 bits (64), Expect = 5.7 Identities = 15/48 (31%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -3 Query: 435 CCPA-----EGATCCKDHSSCCPPDYPVCNIRAGTCSATKNSPLSVKA 307 CCP + + CC S CCPP P C + C P + A Sbjct: 21 CCPPKPCCLQKSPCCPK-SPCCPPKSPCCTPKVCPCPTPCPCPATCPA 67
>KR102_HUMAN (P60368) Keratin-associated protein 10-2 (Keratin-associated| protein 10.2) (High sulfur keratin-associated protein 10.2) (Keratin-associated protein 18-2) (Keratin-associated protein 18.2) Length = 255 Score = 28.9 bits (63), Expect = 7.5 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGA--TCCKDHSSCC 385 CC S + C V CC A TC + SSCC Sbjct: 130 CCASSSCQQSCRVPVCCKAVCCVPTCSESSSSCC 163
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 28.9 bits (63), Expect = 7.5 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGA--TCCKDHSSCCPP 379 CC S + C V CC TC D SCC P Sbjct: 218 CCTSSPCQQACCVPVCCKPVCCVPTCSDDSGSCCQP 253
>CRIM1_BRARE (Q7T3Q2) Cysteine-rich motor neuron 1 protein precursor (CRIM-1)| Length = 1027 Score = 28.9 bits (63), Expect = 7.5 Identities = 29/100 (29%), Positives = 35/100 (35%), Gaps = 2/100 (2%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGATCCKDHSSCCP--PDYPVCNIRAGTCSATKNSPLSVKA 307 C C G R LC C P + + SCCP PD PV T N + Sbjct: 696 CTCHSG-RVLCETEVCPPLLCHSPIRTQDSCCPHCPDDPV------TPQTPSNDSMPSYC 748 Query: 306 LKRTLAMRNTA*SRRGKAVSKVE*KDAAVWSFSPSCTPTN 187 + A S + S D A+ FS SC P N Sbjct: 749 RNEDGDIFLAAESWKPNVCSSCVCLDGAISCFSESCPPVN 788
>LCE2C_HUMAN (Q5TA81) Late cornified envelope protein 2C (Late envelope protein| 11) Length = 110 Score = 28.9 bits (63), Expect = 7.5 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -3 Query: 435 CCPAEGATCCKDHSSCC-PPDYPVCNIRAGTCSATKNSP 322 C PA + C SCC P C+ AG CS + + P Sbjct: 40 CFPAVSSCCGPSSGSCCGPSSGGCCSSGAGGCSLSHHRP 78
>VWF_PIG (Q28833) Von Willebrand factor precursor (vWF) (Fragment)| Length = 2482 Score = 28.5 bits (62), Expect = 9.7 Identities = 23/87 (26%), Positives = 32/87 (36%), Gaps = 17/87 (19%) Frame = +3 Query: 198 CRREKSSTQPHPSIPP*TPLSLDDFMPC---FASPGC------------ASKPSRSAGCS 332 CR+E+ P PS PP +L C + C AS + GC+ Sbjct: 2031 CRKEECPRGPLPSCPPHRTPALRKTQCCDEYECACNCVNTTLSCPLGYLASTVTNDCGCT 2090 Query: 333 WSLSKSQP*CCRRGS--PVGSSWNDPC 407 + C RG+ PVG W + C Sbjct: 2091 TTTCLPDKVCVHRGTVYPVGQFWEEGC 2117
>SGS4_DROME (Q00725) Salivary glue protein Sgs-4 precursor| Length = 297 Score = 28.5 bits (62), Expect = 9.7 Identities = 18/74 (24%), Positives = 25/74 (33%), Gaps = 10/74 (13%) Frame = -3 Query: 432 CPAEGATC------CKDHSSCCPPDYPVCNIRAGTCS----ATKNSPLSVKALKRTLAMR 283 C E TC CK C + P C TC K P K + + Sbjct: 129 CKTEPPTCRTEPPTCKTEPPTCRTEPPTCKTEPPTCKTEPPTCKTEPPCEKHCTKRIKRH 188 Query: 282 NTA*SRRGKAVSKV 241 T ++R K+ K+ Sbjct: 189 RTKRTKRSKSTKKI 202
>FAM5B_HUMAN (Q9C0B6) Protein FAM5B precursor (BMP/retinoic acid-inducible| neural-specific protein 2) (DBCCR1-like protein 2) Length = 783 Score = 28.5 bits (62), Expect = 9.7 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -3 Query: 432 CPAEGATCCKDHSSCCP--PDYPVCNIRAGTCSATKNSPLSVK 310 C +EG CK++ C P +P CN A ++S L ++ Sbjct: 282 CSSEGELVCKENDCWCKCSPTFPECNCPDADIQAMEDSLLQIQ 324
>KR106_HUMAN (P60371) Keratin-associated protein 10-6 (Keratin-associated| protein 10.6) (High sulfur keratin-associated protein 10.6) (Keratin-associated protein 18-6) (Keratin-associated protein 18.6) Length = 365 Score = 28.5 bits (62), Expect = 9.7 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -3 Query: 480 CCCSFGFRNLCLVWGCCPAEGA--TCCKDHSSCC 385 CC S + C V CC TC +D SSCC Sbjct: 218 CCTSSPCQQACCVPVCCVPVCCVPTCSEDSSSCC 251 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,455,192 Number of Sequences: 219361 Number of extensions: 1407268 Number of successful extensions: 4446 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 3918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4341 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)