| Clone Name | rbart43a12 |
|---|---|
| Clone Library Name | barley_pub |
>GBRE_HUMAN (P78334) Gamma-aminobutyric-acid receptor epsilon subunit precursor| (GABA(A) receptor) Length = 506 Score = 28.9 bits (63), Expect = 3.5 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = -3 Query: 276 IVNKQTIANMEPKKMLLLAPRFGRATHARTKDRSTA---PHQTGEVISLVSHE 127 ++ QT A+ PK L PR HART+ RS A HQ V +V+ E Sbjct: 364 LIYNQTKAHASPK---LRHPRINSRAHARTRARSRACARQHQEAFVCQIVTTE 413
>R1B12_SOLDE (Q6L3Z4) Putative late blight resistance protein homolog R1B-12| Length = 1296 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 156 LSGVVLCCDPSCVRA*PGQNEEPEAASSSAPCWRSFVCLLSPIC 287 L+ +V DPS + PG NE+ E R FVC +S C Sbjct: 167 LNVLVKINDPSSLLFVPGPNEQTEQVLKELKLLRFFVCFVSNKC 210
>NOL10_XENLA (Q7T0Q5) Nucleolar protein 10| Length = 689 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 22 EYIHKAHKTRRKENKKRRQPKLPMDQQDA 108 E + K K R+E K+RRQ ++ DQQ A Sbjct: 560 EEVRKQRKLLRQEEKERRQERVREDQQTA 588
>SON_MOUSE (Q9QX47) SON protein| Length = 2404 Score = 28.1 bits (61), Expect = 5.9 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +1 Query: 31 HKAHKTRRKENKKRRQPKLPM--DQQDATATSHH 126 HK HK ++K+ KK ++ K ++ ++ SHH Sbjct: 111 HKKHKNKKKKKKKEKEKKYKRQPEESESKLKSHH 144
>NOL10_XENTR (Q6NVM6) Nucleolar protein 10| Length = 686 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 22 EYIHKAHKTRRKENKKRRQPKLPMDQQDA 108 E + K K R+E K+RRQ ++ DQQ A Sbjct: 557 EEVRKQRKLLRQEEKQRRQERVREDQQTA 585
>RPC1_GIALA (P25202) DNA-directed RNA polymerase III largest subunit (EC| 2.7.7.6) Length = 1741 Score = 27.7 bits (60), Expect = 7.7 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 2/69 (2%) Frame = -3 Query: 291 ESKSGIVNKQTIANMEPKKMLLLAPRFGRATHARTKDRSTAPHQ--TGEVISLVSHEMMT 118 +S++ ++QT ++ L R ART R A HQ + L SH +T Sbjct: 242 QSRNVYASQQTPDSIASNDASQLFSRGSSKLLARTASRFIAQHQGISDRATRLTSHAFLT 301 Query: 117 RSGSVLLIH 91 R V+L H Sbjct: 302 RPQDVILTH 310
>GUNB_CLOCL (P28621) Endoglucanase B precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase B) (Cellulase B) Length = 440 Score = 27.7 bits (60), Expect = 7.7 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 160 LVWCCAAILRACVRSPAKTRSQKQHLL 240 L WCC +++A +R T++Q + L Sbjct: 359 LTWCCPEVMQAFIRGAGATQTQTSYSL 385
>NIA1_ORYSA (P16081) Nitrate reductase [NADH] 1 (EC 1.7.1.1) (NR1)| Length = 916 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 146 ITSPVWCGAVLRSFVRACVARPKRGARSSIFF 241 +++ VW GA LR +R C P +G ++ F Sbjct: 216 VSTSVWRGARLRDVLRRCGIMPSKGGALNVCF 247 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,941,307 Number of Sequences: 219361 Number of extensions: 747085 Number of successful extensions: 2479 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2479 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)