| Clone Name | rbart41a12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATL1M_ARATH (P0C035) Putative RING-H2 finger protein ATL1M | 30 | 1.3 | 2 | STON2_MOUSE (Q8BZ60) Stonin-2 (Stoned B) | 29 | 3.7 | 3 | SYA_ARCFU (O28029) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine-... | 28 | 6.3 | 4 | WZYE_YERPS (Q66G06) Putative ECA polymerase | 28 | 8.2 | 5 | WZYE_YERPE (Q8ZAF1) Putative ECA polymerase | 28 | 8.2 | 6 | STON2_HUMAN (Q8WXE9) Stonin-2 (Stoned B) | 28 | 8.2 |
|---|
>ATL1M_ARATH (P0C035) Putative RING-H2 finger protein ATL1M| Length = 310 Score = 30.4 bits (67), Expect = 1.3 Identities = 18/57 (31%), Positives = 27/57 (47%) Frame = -3 Query: 242 CILCLVADLPPLKTMSLLPRLGYFIEQQKLNMWAKRITLFKLCN*TVGRVGGEANGG 72 C +CL +DL +LPR + ++MW + + LC TVG V +GG Sbjct: 120 CAVCL-SDLVDGDKARVLPRCNHGFHVDCIDMWFQSHSTCPLCRNTVGSVEDTTHGG 175
>STON2_MOUSE (Q8BZ60) Stonin-2 (Stoned B)| Length = 895 Score = 28.9 bits (63), Expect = 3.7 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 Query: 124 NRVIRFAHILSFCCSIKYPSLGNNDIVLSGGKSATKHKIHP 246 + V+ HILSF + LG NDI++ G + ++ I P Sbjct: 590 HHVLTRIHILSFLSGLAECRLGLNDILIKGNEIVSRQDIMP 630
>SYA_ARCFU (O28029) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 906 Score = 28.1 bits (61), Expect = 6.3 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 6/51 (11%) Frame = +3 Query: 33 GLFGHVKAE------PSMVTTVGLSTYSAHGLIT*FKQGYSFCPHIKLLLF 167 G+ G ++ E S+ TVG+S G++ ++ YS H + +LF Sbjct: 299 GIMGELRGERLNQLRKSVADTVGVSVEELEGIVVPLEKVYSLADHTRCILF 349
>WZYE_YERPS (Q66G06) Putative ECA polymerase| Length = 454 Score = 27.7 bits (60), Expect = 8.2 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = -1 Query: 190 YQGLGILLNNKSLICGQNE*PCLN--YVIKPWAE*VERPTVVTIDGSAFTW 44 ++ LG+LL N I Q P + YV P A ERP +V + FTW Sbjct: 271 WENLGLLLQNYDKIDFQGLAPIVRDFYVFIPSALWPERPDLVLNTANYFTW 321
>WZYE_YERPE (Q8ZAF1) Putative ECA polymerase| Length = 454 Score = 27.7 bits (60), Expect = 8.2 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = -1 Query: 190 YQGLGILLNNKSLICGQNE*PCLN--YVIKPWAE*VERPTVVTIDGSAFTW 44 ++ LG+LL N I Q P + YV P A ERP +V + FTW Sbjct: 271 WENLGLLLQNYDKIDFQGLAPIVRDFYVFIPSALWPERPDLVLNTANYFTW 321
>STON2_HUMAN (Q8WXE9) Stonin-2 (Stoned B)| Length = 905 Score = 27.7 bits (60), Expect = 8.2 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 124 NRVIRFAHILSFCCSIKYPSLGNNDIVLSGGKSATKHKIHP 246 + V+ HILSF + LG NDI++ G + + I P Sbjct: 593 HHVLTRIHILSFLSGLAECRLGLNDILVKGNEIVLRQDIMP 633 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,760,750 Number of Sequences: 219361 Number of extensions: 761411 Number of successful extensions: 1680 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1680 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)