| Clone Name | rbart39g02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CT2NL_MOUSE (Q99LJ0) CTTNBP2 N-terminal-like protein | 29 | 7.3 | 2 | ZBT20_HUMAN (Q9HC78) Zinc finger and BTB domain-containing prote... | 28 | 9.6 |
|---|
>CT2NL_MOUSE (Q99LJ0) CTTNBP2 N-terminal-like protein| Length = 638 Score = 28.9 bits (63), Expect = 7.3 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = +3 Query: 105 GCAAGKQERATMPPHAPESHDARQQDNDRPQEIVSTPTNTGXXXXSLL 248 GC G + TMP H P S + + + S+P ++ LL Sbjct: 391 GCPVGTETPVTMPSHLPSSGSSLSPSSTASSSLTSSPCSSPVLTKRLL 438
>ZBT20_HUMAN (Q9HC78) Zinc finger and BTB domain-containing protein 20 (Zinc| finger protein 288) (Dendritic-derived BTB/POZ zinc finger protein) Length = 741 Score = 28.5 bits (62), Expect = 9.6 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 73 KPLLLQTQHSTAAQQGNKKERPCPRTHQKVTTQDNKI 183 +PL HSTA+ QG KK C ++ T + N + Sbjct: 558 QPLASSAGHSTASGQGEKKPYECTLCNKTFTAKQNYV 594 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,860,267 Number of Sequences: 219361 Number of extensions: 1160358 Number of successful extensions: 3095 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3093 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)