| Clone Name | rbart37g02 |
|---|---|
| Clone Library Name | barley_pub |
>SMS2_CAEEL (Q20735) Putative phosphatidylcholine:ceramide| cholinephosphotransferase 2 (EC 2.7.-.-) (Sphingomyelin synthase 2) Length = 335 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 Query: 204 DFVPYQPLPLINCIIFPSQRW 142 D VP QPLP + +I P QRW Sbjct: 82 DVVPRQPLPDLTFMIIPQQRW 102
>MTA1_RUEGE (P94147) Modification methylase AgeI (EC 2.1.1.37)| (Cytosine-specific methyltransferase AgeI) (M.AgeI) Length = 429 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 7 PRHRNTIFSLRGQDISRTTPPSPLIKFRKQKSIIENSKPS 126 P+HR +F D R PP P K+ ++ N +PS Sbjct: 158 PQHRRRVFIFGAADGQRIDPPQPSHVNGKRSGVVLNDQPS 197
>GRIA2_RAT (P19491) Glutamate receptor 2 precursor (GluR-2) (GluR-B) (GluR-K2)| (Glutamate receptor ionotropic, AMPA 2) (AMPA-selective glutamate receptor 2) Length = 883 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/44 (31%), Positives = 28/44 (63%) Frame = +2 Query: 41 DRT*VEPLLPLLSSNFESKKVLLKTRNHQMLHASQRWEGKIIQL 172 D + +E ++++ ES V++K +NH+ML ++R+EG + L Sbjct: 407 DTSGLENKTVVVTTILESPYVMMK-KNHEMLEGNERYEGYCVDL 449
>GRIA2_PONPY (Q5R4M0) Glutamate receptor 2 precursor (GluR-2) (GluR-B) (GluR-K2)| (Glutamate receptor ionotropic, AMPA 2) (AMPA-selective glutamate receptor 2) Length = 883 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/44 (31%), Positives = 28/44 (63%) Frame = +2 Query: 41 DRT*VEPLLPLLSSNFESKKVLLKTRNHQMLHASQRWEGKIIQL 172 D + +E ++++ ES V++K +NH+ML ++R+EG + L Sbjct: 407 DTSGLENKTVVVTTILESPYVMMK-KNHEMLEGNERYEGYCVDL 449
>GRIA2_MOUSE (P23819) Glutamate receptor 2 precursor (GluR-2) (GluR-B) (GluR-K2)| (Glutamate receptor ionotropic, AMPA 2) (AMPA-selective glutamate receptor 2) Length = 883 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/44 (31%), Positives = 28/44 (63%) Frame = +2 Query: 41 DRT*VEPLLPLLSSNFESKKVLLKTRNHQMLHASQRWEGKIIQL 172 D + +E ++++ ES V++K +NH+ML ++R+EG + L Sbjct: 407 DTSGLENKTVVVTTILESPYVMMK-KNHEMLEGNERYEGYCVDL 449
>GRIA2_HUMAN (P42262) Glutamate receptor 2 precursor (GluR-2) (GluR-B) (GluR-K2)| (Glutamate receptor ionotropic, AMPA 2) (AMPA-selective glutamate receptor 2) Length = 883 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/44 (31%), Positives = 28/44 (63%) Frame = +2 Query: 41 DRT*VEPLLPLLSSNFESKKVLLKTRNHQMLHASQRWEGKIIQL 172 D + +E ++++ ES V++K +NH+ML ++R+EG + L Sbjct: 407 DTSGLENKTVVVTTILESPYVMMK-KNHEMLEGNERYEGYCVDL 449
>NFKB1_HUMAN (P19838) Nuclear factor NF-kappa-B p105 subunit (DNA-binding factor| KBF1) (EBP-1) [Contains: Nuclear factor NF-kappa-B p50 subunit] Length = 968 Score = 28.1 bits (61), Expect = 6.2 Identities = 20/61 (32%), Positives = 31/61 (50%) Frame = +1 Query: 43 QDISRTTPPSPLIKFRKQKSIIENSKPSNASR*PALGGKNNTID*GKRLVRNEIDSTHGG 222 +DI+ T P S ++ R+ KS +E S+P P + K ++L+ N DS GG Sbjct: 319 KDINITKPASVFVQLRR-KSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGG 377 Query: 223 S 225 S Sbjct: 378 S 378
>REPS2_HUMAN (Q8NFH8) RalBP1-associated Eps domain-containing protein 2| (RalBP1-interacting protein 2) (Partner of RalBP1) Length = 660 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +1 Query: 43 QDISRTTPPSPLI--KFRKQKSIIENSKPSNASR*PA 147 +D+ + PPS I KFR + EN +PS A+ PA Sbjct: 554 KDVLYSQPPSKPIRRKFRPENQATENQEPSTAASGPA 590
>NFKB1_MOUSE (P25799) Nuclear factor NF-kappa-B p105 subunit (DNA-binding factor| KBF1) (EBP-1) (NF-kappa-B1 p84/NF-kappa-B1 p98) [Contains: Nuclear factor NF-kappa-B p50 subunit] Length = 971 Score = 27.7 bits (60), Expect = 8.1 Identities = 19/61 (31%), Positives = 31/61 (50%) Frame = +1 Query: 43 QDISRTTPPSPLIKFRKQKSIIENSKPSNASR*PALGGKNNTID*GKRLVRNEIDSTHGG 222 +D++ T P S ++ R+ KS +E S+P P + K ++L+ N DS GG Sbjct: 317 KDVNITKPASVFVQLRR-KSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGG 375 Query: 223 S 225 S Sbjct: 376 S 376
>RUMB_VIBCH (Q9KL20) 23S rRNA (uracil-5-)-methyltransferase rumB (EC 2.1.1.-)| (23S rRNA(M-5-U747)-methyltransferase) Length = 375 Score = 27.7 bits (60), Expect = 8.1 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -3 Query: 231 ASGSPVRGVDFVPYQPLPLINCIIFPS--QRWLA*SI*WFRV 112 A+ +P+ G++ QPL L+ C ++P Q LA W R+ Sbjct: 66 AAHAPILGIEDAQGQPLSLVTCPLYPQPMQELLAYLENWIRI 107
>NFKB1_CANFA (Q6F3J0) Nuclear factor NF-kappa-B p105 subunit [Contains: Nuclear| factor NF-kappa-B p50 subunit] Length = 972 Score = 27.7 bits (60), Expect = 8.1 Identities = 19/61 (31%), Positives = 31/61 (50%) Frame = +1 Query: 43 QDISRTTPPSPLIKFRKQKSIIENSKPSNASR*PALGGKNNTID*GKRLVRNEIDSTHGG 222 +D++ T P S ++ R+ KS +E S+P P + K ++L+ N DS GG Sbjct: 319 KDVNITKPTSVFVQLRR-KSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGG 377 Query: 223 S 225 S Sbjct: 378 S 378 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,963,791 Number of Sequences: 219361 Number of extensions: 646662 Number of successful extensions: 1340 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1329 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1340 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)