| Clone Name | rbart37a01 |
|---|---|
| Clone Library Name | barley_pub |
>ZN335_HUMAN (Q9H4Z2) Zinc finger protein 335| Length = 1342 Score = 29.3 bits (64), Expect = 2.5 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 235 YPLVPCAAMPRP*CHEWPPSPLANRCSGFSRAHPTMPSAAA 357 +PL+ C +PR PPSP C G S++ + P A + Sbjct: 959 WPLLQCGGLPRD--GPEPPSPAKTHCVGDSQSSASSPPATS 997
>SETBP_MOUSE (Q9Z180) SET-binding protein (SEB)| Length = 1535 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +1 Query: 229 PPYPLVPCAAMPRP*CHEWPPSPLANRCSGFSRAHPTMPSAAAAK 363 PP P P +P P PP PL G R H P A A+ Sbjct: 1462 PPLPPPPPPPLPPPPPPPPPPPPLPKTARGGKRKHRPQPPAQPAQ 1506
>POF21_ARATH (Q04088) Probable transcription factor PosF21 (AtbZIP59)| Length = 398 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 238 PLVPCAAMPRP*CHEWPPSPLANRCSGFSRAHP 336 P PC +P PPSP + RCS FS A P Sbjct: 7 PAPPCGGLP-------PPSP-SGRCSAFSEAGP 31
>KI13B_HUMAN (Q9NQT8) Kinesin-like protein KIF13B (Kinesin-like protein GAKIN)| Length = 1826 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 229 PPYPLVPCAAMPRP*CHEWPPSPLANRCSGF 321 PP + A P P + PPSPL+ SG+ Sbjct: 1538 PPPVIAVTAVTPAPEAQDGPPSPLSEASSGY 1568
>PALH_NEUCR (Q7RY98) pH-response regulator protein palH/rim-21| Length = 778 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 200 RLRPCMDPSSLPTLWSPAPPCRG 268 + RP +D ++LP PAPP RG Sbjct: 627 KFRPTLDTNNLPVTVIPAPPRRG 649
>CD3H_MOUSE (P29020) T-cell surface glycoprotein CD3 eta chain precursor| (T-cell receptor T3 eta chain) Length = 206 Score = 27.3 bits (59), Expect = 9.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 212 CMDPSSLPTLWSPAPP 259 C S+PTLWSP PP Sbjct: 185 CASVFSIPTLWSPWPP 200
>TYPH_MOUSE (Q99N42) Thymidine phosphorylase (EC 2.4.2.4) (TdRPase) (TP)| Length = 471 Score = 27.3 bits (59), Expect = 9.4 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -2 Query: 362 LAAAAEGIVGCARLNPLQRFARGLGGHSWHYGRGMAAQ 249 L A A+GIV C R PL R LG GR A Q Sbjct: 367 LLAPADGIVECVRALPLARVLHDLGA-----GRSRAGQ 399
>KCNH4_HUMAN (Q9UQ05) Potassium voltage-gated channel subfamily H member 4| (Voltage-gated potassium channel subunit Kv12.3) (Ether-a-go-go-like potassium channel 1) (ELK channel 1) (ELK1) (Brain-specific eag-like channel 2) (BEC2) Length = 1017 Score = 27.3 bits (59), Expect = 9.4 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 220 SLIPPYPLVPCAAMPRP*CHEWPPSPLANRCSGFSRA 330 S++PPYP P P P PP+P R S SR+ Sbjct: 977 SILPPYPSEPDPLGPSPVPEASPPTPSLLRHSFQSRS 1013 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,355,192 Number of Sequences: 219361 Number of extensions: 761623 Number of successful extensions: 1841 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1840 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)