| Clone Name | rbart34a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ECM37_YEAST (P40458) Extracellular matrix protein 37 | 33 | 0.17 | 2 | HEX8_ADEM1 (P19722) Hexon-associated protein precursor (Protein ... | 28 | 5.5 | 3 | SORC1_MOUSE (Q9JLC4) VPS10 domain-containing receptor SorCS1 pre... | 28 | 5.5 | 4 | OPT5_ARATH (Q9SUA4) Oligopeptide transporter 5 (AtOPT5) | 28 | 7.2 | 5 | DPOL_ARCFU (O29753) DNA polymerase (EC 2.7.7.7) | 27 | 9.4 |
|---|
>ECM37_YEAST (P40458) Extracellular matrix protein 37| Length = 529 Score = 33.1 bits (74), Expect = 0.17 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +1 Query: 106 TRAYARTKNSTKCKL*NINSGPSTFRSRHFMFSCLPTS*APWGLTLCFGVSLGCC 270 +R+Y R K + K + S R + F TS WG+++ G+S GCC Sbjct: 356 SRSYCRNKKAENSKKKSPKSNKKPKRKKQKFF----TSWFTWGISITIGISFGCC 406
>HEX8_ADEM1 (P19722) Hexon-associated protein precursor (Protein VIII) (pVIII)| Length = 215 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -1 Query: 305 FQPRNDAFEHKPQHPSDTPKHSVSPHGAQLVG 210 FQPR A P HP DT +++ +GAQL G Sbjct: 78 FQPRPQAIPVHPAHP-DTFDAALTSNGAQLAG 108
>SORC1_MOUSE (Q9JLC4) VPS10 domain-containing receptor SorCS1 precursor (mSorCS)| Length = 1167 Score = 28.1 bits (61), Expect = 5.5 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 Query: 272 PQHPSDTPKHSVSPHG 225 PQHPS TP+ +++P G Sbjct: 40 PQHPSSTPRRTLTPRG 55
>OPT5_ARATH (Q9SUA4) Oligopeptide transporter 5 (AtOPT5)| Length = 753 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 43 GYKHENLDVSSTVHRAATFPVTRAYARTKNSTKCKL*NIN 162 GY+ L VSS V + T P+ + A T +TK +L N Sbjct: 75 GYRSNPLTVSSVVAQIITLPLGKLMATTLPTTKLRLPGTN 114
>DPOL_ARCFU (O29753) DNA polymerase (EC 2.7.7.7)| Length = 781 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Frame = -1 Query: 251 PKHSVSPHGAQLV----GRHENIKCLDLKVDGPELM 156 P+H+ S GA ++ G HEN+ CLD P +M Sbjct: 385 PEHAESYEGAFVLEPERGLHENVACLDFASMYPSIM 420 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,128,915 Number of Sequences: 219361 Number of extensions: 1046781 Number of successful extensions: 2461 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2461 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)