| Clone Name | rbart33h02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POMT1_MOUSE (Q8R2R1) Protein O-mannosyl-transferase 1 (EC 2.4.1.... | 31 | 3.1 | 2 | PYGO1_HUMAN (Q9Y3Y4) Pygopus homolog 1 | 30 | 6.9 | 3 | Y1528_MYCBO (P67118) Hypothetical UPF0043 protein Mb1528c | 29 | 9.0 | 4 | Y1491_MYCTU (P67117) Hypothetical UPF0043 protein Rv1491c/MT1538 | 29 | 9.0 | 5 | ICP0_HHV2H (P28284) Trans-acting transcriptional protein ICP0 (V... | 29 | 9.0 |
|---|
>POMT1_MOUSE (Q8R2R1) Protein O-mannosyl-transferase 1 (EC 2.4.1.109)| (Dolichyl-phosphate-mannose--protein mannosyltransferase 1) Length = 746 Score = 30.8 bits (68), Expect = 3.1 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = -1 Query: 589 LVWTSDSLNASTANSSISSWLLL-YTRSLCTL-ETAWTRW 476 ++WTS SL A+ + + W LL RS+C L E AW+RW Sbjct: 598 VIWTSASL-ATVVYTLLFFWYLLRRRRSICDLPEDAWSRW 636
>PYGO1_HUMAN (Q9Y3Y4) Pygopus homolog 1| Length = 419 Score = 29.6 bits (65), Expect = 6.9 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 19 NRASTKPRQPAGRANAITTSQHK*IYSYPNIYHH 120 N KPRQP G A+A TT + +PN + H Sbjct: 301 NGTQNKPRQPRGAADACTTEKSNKSSLHPNRHGH 334
>Y1528_MYCBO (P67118) Hypothetical UPF0043 protein Mb1528c| Length = 252 Score = 29.3 bits (64), Expect = 9.0 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 252 QAMETVEEDVEEYSWREVVLPRLIPVVPHAA 344 +A+ ++E + E W ++ RLIPVVP AA Sbjct: 135 RAINRLDERLRERGWLAILSLRLIPVVPFAA 165
>Y1491_MYCTU (P67117) Hypothetical UPF0043 protein Rv1491c/MT1538| Length = 252 Score = 29.3 bits (64), Expect = 9.0 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 252 QAMETVEEDVEEYSWREVVLPRLIPVVPHAA 344 +A+ ++E + E W ++ RLIPVVP AA Sbjct: 135 RAINRLDERLRERGWLAILSLRLIPVVPFAA 165
>ICP0_HHV2H (P28284) Trans-acting transcriptional protein ICP0 (VMW118 protein)| Length = 825 Score = 29.3 bits (64), Expect = 9.0 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 2 GLVGEGTAPARNPGSRQAEPTPS 70 GL+ T PAR P RQ PTP+ Sbjct: 79 GLMDAATPPARPPAERQGSPTPA 101 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,528,927 Number of Sequences: 219361 Number of extensions: 983990 Number of successful extensions: 5725 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5716 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)