| Clone Name | rbart33f10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA... | 31 | 0.81 | 2 | NUOA_BUCBP (Q89AU6) NADH-quinone oxidoreductase chain A (EC 1.6.... | 28 | 5.3 | 3 | IFRD1_MOUSE (P19182) Interferon-related developmental regulator ... | 28 | 5.3 | 4 | SRA21_CAEEL (O18690) Serpentine receptor class alpha-21 (Protein... | 28 | 6.9 | 5 | ZN759_HUMAN (Q8NAF0) Zinc finger protein 579 | 27 | 9.0 |
|---|
>UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA replication| protein BSLF1) Length = 874 Score = 30.8 bits (68), Expect = 0.81 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -1 Query: 255 SKHVRTYVRRRTALAMHITHANVRTRMEHLLFFRWIGSP 139 ++H+RTY R T LA H+ ++ RME + W P Sbjct: 312 AEHMRTYFTRETYLAEHVRVQQLKIRMEPPAPYTWDPDP 350
>NUOA_BUCBP (Q89AU6) NADH-quinone oxidoreductase chain A (EC 1.6.99.5) (NADH| dehydrogenase I, chain A) (NDH-1, chain A) Length = 132 Score = 28.1 bits (61), Expect = 5.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 116 WGFLAFFFVVIKTCVIMIML 57 W F FFF+ + CV M+ + Sbjct: 12 WAFFTFFFIAVSICVFMLSI 31
>IFRD1_MOUSE (P19182) Interferon-related developmental regulator 1 (Nerve growth| factor-inducible protein PC4) (TPA-induced sequence 7) (TIS7 protein) Length = 449 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +2 Query: 200 VICM-ASAVRRRTYVRTCLLLCSYLDTGERPQIHNNLKCF 316 +IC A++++ R TC +C ++ T + ++++ L+CF Sbjct: 174 IICDGAASIQARQTCATCFGVCCFIATDDITELYSTLECF 213
>SRA21_CAEEL (O18690) Serpentine receptor class alpha-21 (Protein sra-21)| Length = 339 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/65 (24%), Positives = 30/65 (46%) Frame = -2 Query: 245 YVRTYDDALHLPCISRMQTYVHAWNICYSFDGSGLLPVCVHFTWGFLAFFFVVIKTCVIM 66 + Y A+ L + + T V + Y +G +PVC+H+ LA + + T + Sbjct: 145 HTHQYFIAVSLLVLQLLLTLVSFYIAYYGVHLAGYVPVCIHYP--RLAVHYSTVNTVRTV 202 Query: 65 IMLVC 51 +M+ C Sbjct: 203 VMVCC 207
>ZN759_HUMAN (Q8NAF0) Zinc finger protein 579| Length = 562 Score = 27.3 bits (59), Expect = 9.0 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 8/76 (10%) Frame = +2 Query: 137 GGDPIHRKNNKCSMRVRTFACVICMA-----SAVRRRTYVRTCLL---LCSYLDTGERPQ 292 GG P K ++CS+ ++ FA ++ + R C L L SYL R Sbjct: 261 GGPPPRPKRHQCSICLKAFARPWSLSRHRLVHSTDRPFVCPDCGLAFRLASYLRQHRR-- 318 Query: 293 IHNNLKCFLPLPAASK 340 +H L PLPAA K Sbjct: 319 VHGPLSLLAPLPAAGK 334 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,991,677 Number of Sequences: 219361 Number of extensions: 1254148 Number of successful extensions: 2748 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2742 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)