| Clone Name | rbart33f08 |
|---|---|
| Clone Library Name | barley_pub |
>URIC_ARATH (O04420) Uricase (EC 1.7.3.3) (Urate oxidase) (Nodulin 35 homolog)| Length = 309 Score = 61.6 bits (148), Expect = 1e-09 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 484 KENPGLVKFADDVYMPTDEPHGTIEATLSRANSK 383 KENP +VKF DDVY+PTDEPHG+IEATLSR SK Sbjct: 275 KENPSMVKFKDDVYLPTDEPHGSIEATLSRITSK 308
>URIC_PHAVU (P53763) Uricase-2 (EC 1.7.3.3) (Uricase II) (Urate oxidase)| (Nodule-specific uricase) Length = 308 Score = 50.8 bits (120), Expect = 2e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 484 KENPGLVKFADDVYMPTDEPHGTIEATLSRANSK 383 K+ P +VKF DDVY+PTDEPHG+IEA+LSR SK Sbjct: 275 KDGP-IVKFEDDVYLPTDEPHGSIEASLSRVWSK 307
>URIC2_SOYBN (O04104) Uricase-2 isozyme 2 (EC 1.7.3.3) (Uricase II isozyme 2)| (Urate oxidase) (Nodulin 35) (N-35) (Non-symbiotic uricase) Length = 309 Score = 49.3 bits (116), Expect = 5e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -3 Query: 484 KENPGLVKFADDVYMPTDEPHGTIEATLSRANSK 383 K+ P +VKF DDVY+PTDEPHG+I+A+LSR SK Sbjct: 276 KDGP-IVKFEDDVYLPTDEPHGSIQASLSRLWSK 308
>URIC1_SOYBN (P04670) Uricase-2 isozyme 1 (EC 1.7.3.3) (Uricase II isozyme 1)| (Urate oxidase) (Nodulin 35) (N-35) (Nodule-specific uricase) Length = 309 Score = 48.5 bits (114), Expect = 9e-06 Identities = 21/29 (72%), Positives = 26/29 (89%) Frame = -3 Query: 469 LVKFADDVYMPTDEPHGTIEATLSRANSK 383 +VKF DDVY+PTDEPHG+I+A+LSR SK Sbjct: 280 IVKFEDDVYLPTDEPHGSIQASLSRLWSK 308
>URIC2_CANLI (P34799) Uricase-2 isozyme 2 (EC 1.7.3.3) (Uricase II clone| pcClNUO-02) (Urate oxidase) Length = 301 Score = 48.1 bits (113), Expect = 1e-05 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -3 Query: 484 KENPGLVKFADDVYMPTDEPHGTIEATLSRANSK 383 K+ P +VKF DDVY PTDEPHG+I+A+LSR SK Sbjct: 268 KDGP-IVKFDDDVYFPTDEPHGSIQASLSRLWSK 300
>URIC1_CANLI (P34798) Uricase-2 isozyme 1 (EC 1.7.3.3) (Uricase II clone| pcClNUO-01) (Urate oxidase) Length = 308 Score = 44.3 bits (103), Expect = 2e-04 Identities = 21/34 (61%), Positives = 27/34 (79%) Frame = -3 Query: 484 KENPGLVKFADDVYMPTDEPHGTIEATLSRANSK 383 K+ P +VKF DVY+PTDEPHG+I+A+L R SK Sbjct: 275 KDGP-IVKFEADVYLPTDEPHGSIQASLRRLWSK 307
>URIC_DROVI (P23194) Uricase (EC 1.7.3.3) (Urate oxidase)| Length = 342 Score = 34.3 bits (77), Expect = 0.18 Identities = 14/24 (58%), Positives = 20/24 (83%) Frame = -3 Query: 454 DDVYMPTDEPHGTIEATLSRANSK 383 ++V++PTD+PHGTI A LSR + K Sbjct: 316 NEVFIPTDKPHGTIYAQLSRKSLK 339
>URIC_DROPS (P22673) Uricase (EC 1.7.3.3) (Urate oxidase)| Length = 345 Score = 32.0 bits (71), Expect = 0.90 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = -3 Query: 454 DDVYMPTDEPHGTIEATLSRAN 389 ++V++P D+PHGTI A L+R N Sbjct: 319 NEVFIPVDKPHGTIYAQLARKN 340
>URIC_DROSU (O44111) Uricase (EC 1.7.3.3) (Urate oxidase) (Fragment)| Length = 339 Score = 32.0 bits (71), Expect = 0.90 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = -3 Query: 454 DDVYMPTDEPHGTIEATLSRAN 389 ++V++P D+PHGTI A L+R N Sbjct: 313 NEVFIPVDKPHGTIYAQLARKN 334
>URIC_DROME (P16163) Uricase (EC 1.7.3.3) (Urate oxidase)| Length = 352 Score = 32.0 bits (71), Expect = 0.90 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = -3 Query: 454 DDVYMPTDEPHGTIEATLSRAN 389 ++V++P D+PHGTI A L+R N Sbjct: 326 NEVFIPVDKPHGTIYAQLARKN 347
>Y1618_AQUAE (O67545) Hypothetical protein aq_1618| Length = 413 Score = 29.6 bits (65), Expect = 4.4 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -1 Query: 162 CSTCLLFNRGNLYFFFFGTLGV*MRSFHVSRFNVIWFLL 46 CS C+LF G L FFF SF +S F V++ LL Sbjct: 238 CSLCVLFFTGTLMLFFFPHFSY-SYSFWLSFFAVLYILL 275 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,888,612 Number of Sequences: 219361 Number of extensions: 1418386 Number of successful extensions: 2623 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2623 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)