| Clone Name | rbart33c09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KCNK9_MOUSE (Q3LS21) Potassium channel subfamily K member 9 (Aci... | 31 | 2.3 | 2 | CB024_RAT (Q6P7B2) Protein C2orf24 homolog | 30 | 5.1 | 3 | YNIF_AZOBR (P25316) Hypothetical 12.3 kDa protein in nifK-nifY i... | 29 | 6.7 | 4 | RSH1_MAIZE (Q41853) Homeobox protein rough sheath 1 | 29 | 6.7 | 5 | MBD1_MOUSE (Q9Z2E2) Methyl-CpG-binding domain protein 1 (Methyl-... | 29 | 6.7 |
|---|
>KCNK9_MOUSE (Q3LS21) Potassium channel subfamily K member 9 (Acid-sensitive| potassium channel protein TASK-3) (TWIK-related acid-sensitive K(+) channel 3) Length = 402 Score = 30.8 bits (68), Expect = 2.3 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 338 WGDHEDDIDGGDMAPNGRLTAPPALPAP 421 WG +DD D D+ N +TAP + PAP Sbjct: 305 WGKDDDDDDDDDVVDNVVVTAPISAPAP 332
>CB024_RAT (Q6P7B2) Protein C2orf24 homolog| Length = 408 Score = 29.6 bits (65), Expect = 5.1 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Frame = +2 Query: 299 LTRMSCCVEKS----SMWGDHEDDIDGGDMAPNGRLTAPPALPAPCNSCAYRRRSGYGTT 466 LT +S C+E S S+WG D + M P PPA P P + C + ++ Sbjct: 290 LTNVSSCLEDSVELPSLWGSLLDPLTPPLMPPPD----PPAPPTPFHKCPFCQKFQRNPP 345 Query: 467 ACCWC 481 C C Sbjct: 346 NCRAC 350
>YNIF_AZOBR (P25316) Hypothetical 12.3 kDa protein in nifK-nifY intergenic| region Length = 118 Score = 29.3 bits (64), Expect = 6.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 455 YGTTACCWCSGGRIA 499 Y +TACCW +GGR A Sbjct: 10 YASTACCWLAGGRHA 24
>RSH1_MAIZE (Q41853) Homeobox protein rough sheath 1| Length = 351 Score = 29.3 bits (64), Expect = 6.7 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +2 Query: 275 IAAAGDAGLTRMSCCVEKSSMWGDHEDDIDGGDMAPNGRLTAPPAL 412 I+ G + R+S KS G EDD+D PNGR PP + Sbjct: 184 ISGGGGSSSARLSLADGKSEGVGSSEDDMD-----PNGRENDPPEI 224
>MBD1_MOUSE (Q9Z2E2) Methyl-CpG-binding domain protein 1 (Methyl-CpG-binding| protein MBD1) Length = 636 Score = 29.3 bits (64), Expect = 6.7 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = +2 Query: 296 GLTRMSCCVEKSSMWGDHEDDIDGGDMAPNGRLTAPPALPAPCN 427 GL R C+++ WG + G +A APP P P + Sbjct: 268 GLKRQWRCLQRRCFWGKRDSSKRGSKVASQRHSQAPPLPPHPAS 311 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,956,491 Number of Sequences: 219361 Number of extensions: 1048817 Number of successful extensions: 2922 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2922 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)