| Clone Name | rbart28c04 |
|---|---|
| Clone Library Name | barley_pub |
>GAG_SIVG1 (Q02843) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 513 Score = 29.3 bits (64), Expect = 5.8 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -3 Query: 485 EEREQKRKQATSRATFVQDLVLSTLFGDD 399 EEREQ RKQ V+D+ LS+LFG D Sbjct: 487 EEREQTRKQKEKE---VEDVSLSSLFGGD 512
>DOS_ECOLI (P76129) Heme-regulated cyclic AMP phosphodiesterase (EC 3.1.4.-)| (Direct oxygen sensor protein) Length = 807 Score = 29.3 bits (64), Expect = 5.8 Identities = 15/57 (26%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = -2 Query: 234 ILFGLDTYTLIYGSLSRISLCRRIIGQRFLALYH--PFHRQGTIVCTNITGLLHTLH 70 +L L + + ++ R++ G A+ PFH G I+C NI +L+ H Sbjct: 242 VLAHLQNLVMTFSDITEERQIRQLEGNILAAMCSSPPFHEMGEIICRNIESVLNESH 298
>SRA21_CAEEL (O18690) Serpentine receptor class alpha-21 (Protein sra-21)| Length = 339 Score = 29.3 bits (64), Expect = 5.8 Identities = 16/46 (34%), Positives = 29/46 (63%), Gaps = 4/46 (8%) Frame = -1 Query: 151 VPCLVPSF---SSSRDNRLYQHHRAVTYATQ-CNEKYRSSTCVEEI 26 + CL+ S ++ ++R+ Q +R+ +A++ CN YRSS CV E+ Sbjct: 68 IACLLNSVVHQTTMLESRMRQTYRSFVFASEPCNLLYRSSDCVFEL 113
>YWCF_BACSU (P39604) Hypothetical protein ywcF| Length = 393 Score = 29.3 bits (64), Expect = 5.8 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 135 HPFHRQGTIVCTNITGL--LHTLHNAMRNIEVPPV 37 HPF+R + C T L +HT N NI + PV Sbjct: 317 HPFNRFASFFCVGYTALIVIHTFQNIGMNIGIMPV 351
>PFPN_ENTHI (Q07831) Nonpathogenic pore-forming peptide precursor (APNP)| Length = 97 Score = 28.5 bits (62), Expect = 9.9 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -2 Query: 123 RQGTIVCTNITGLLHTLHNAM 61 RQG IVC TGL++TL N + Sbjct: 19 RQGPIVCNLCTGLINTLENLL 39
>LAMP3_MOUSE (Q7TST5) Lysosome-associated membrane glycoprotein 3 precursor| (LAMP-3) (Lysosomal-associated membrane protein 3) (DC-lysosome-associated membrane glycoprotein) (DC LAMP) (CD208 antigen) Length = 411 Score = 28.5 bits (62), Expect = 9.9 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -1 Query: 457 PLAGRPLCKTWSSPLYLETTECSNG 383 PL RP TWSSP + T E NG Sbjct: 204 PLVPRPTLVTWSSPAKIGTYEVLNG 228
>DOCK6_MOUSE (Q8VDR9) Dedicator of cytokinesis protein 6 (Fragment)| Length = 849 Score = 28.5 bits (62), Expect = 9.9 Identities = 18/54 (33%), Positives = 24/54 (44%) Frame = -1 Query: 475 NKSGNKPLAGRPLCKTWSSPLYLETTECSNGPTFSLLDGCFLHADSDRTAALCL 314 N S +AG PL T S GP+ + GC L A+S RT +C+ Sbjct: 13 NPSVAMAIAGGPLAPG-------SRTSISQGPSTAARSGCPLSAESSRTLLVCV 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,590,788 Number of Sequences: 219361 Number of extensions: 1535140 Number of successful extensions: 3393 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3393 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)